Together with bola2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (By similarity). Required for hemoglobin maturation (PubMed:23615448). Does not possess any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity (By similarity).

326 amino acids

MANFTDAASLQQFDELLKNNSKSLTVVHFHAPWAPQCSQMNDVMAELAKEHKHTMFVKLEAEAVPEVSEKYEITSVPTFLFFKGGEKIDRLDGAHAPELTNKVQRLGSGGGGAVGAGDVPKEDLNQRLKRLINAAPCMLFMKGSPQEPRCGFSRQIIQILKDHNVQYSSFDILSDEEVRQGLKTYSNWPTYPQVYVSGELIGGLDIVKELVESGELENTFPKTVSLENRLKSLINKSPVMLFMKGNKEAAKCGFSRQILEIMNNTGVEYDTFDILEDEEVRQGLKTYSNWPTFPQLYVKGDLIGGLDIVKELLEGGELVSVLKGEN

36.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make glrx3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here