GATA4

Transcription factor GATA-4

442 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development. In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression. Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions. Acts as a transcriptional activator of ANF in cooperation with NKX2-5. Promotes cardiac myocyte enlargement. Required during testicular development. May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase.

44.487 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGGAAASGASSGGGSGGAPSAAGPGAQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGGGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPSGGESLPPASSASSNSSNVATSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSVSAMSGHGPSIHPVLSALKLSPQGYTSSVSQSPQASSKQDPWNSLALADSHGDIITA

GATA4

Transcription factor GATA-4

442 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development and function (PubMed:24000169, PubMed:27984724). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (PubMed:27984724). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (PubMed:20081228). Required during testicular development (PubMed:21220346). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (PubMed:15734735).

44.565 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

GATA4

Transcription factor GATA-4

442 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development. In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression. Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions. Acts as a transcriptional activator of ANF in cooperation with NKX2-5. Promotes cardiac myocyte enlargement. Required during testicular development. May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase.

44.487 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGGAAASGASSGGGSGGAPSAAGPGAQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGGGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPSGGESLPPASSASSNSSNVATSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSVSAMSGHGPSIHPVLSALKLSPQGYTSSVSQSPQASSKQDPWNSLALADSHGDIITA

GATA4

Transcription factor GATA-4

442 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development and function (PubMed:24000169, PubMed:27984724). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (PubMed:27984724). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression. Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (PubMed:20081228). Required during testicular development (PubMed:21220346). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (PubMed:15734735).

44.565 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHGAGAASSPVYVPTPRVPSSVLGLSYLQGGGAGSASGGASGGSSGGAASGAGPGTQQGSPGWSQAGADGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSGGGAAGAGLAGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

Gata4

Transcription factor GATA-4

441 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development (By similarity). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (By similarity). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (By similarity). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (PubMed:9584153). Promotes cardiac myocyte enlargement (By similarity). Required during testicular development (By similarity). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (By similarity).

44.58 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSAAAAGTTSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGSGGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGETLPPSSGASSGNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGPSIHPVLSALKLSPQGYASPVTQTSQASSKQDSWNSLVLADSHGDIITA

Gata4

Transcription factor GATA-4

441 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development (By similarity). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (By similarity). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (By similarity). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (PubMed:9584153). Promotes cardiac myocyte enlargement (By similarity). Required during testicular development (By similarity). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (By similarity).

44.58 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSAAAAGTTSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYGSGGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGETLPPSSGASSGNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGPSIHPVLSALKLSPQGYASPVTQTSQASSKQDSWNSLVLADSHGDIITA

Gata4

Transcription factor GATA-4

440 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development (By similarity). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (By similarity). Required during testicular development (By similarity). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (PubMed:15329343). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (PubMed:15329343). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (By similarity).

44.597 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSGAASGATSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSSGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPPGESLPPSSGASSNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGSSIHPVLSALKLSPQGYPSPVTQTSQASSKQDSWNSLVLADSHGDIITA

Gata4

Transcription factor GATA-4

440 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3' and plays a key role in cardiac development (By similarity). In cooperation with TBX5, it binds to cardiac super-enhancers and promotes cardiomyocyte gene expression, while it downregulates endocardial and endothelial gene expression (By similarity). Acts as a transcriptional activator of ANF in cooperation with NKX2-5 (By similarity). Promotes cardiac myocyte enlargement (By similarity). Required during testicular development (By similarity). Involved in bone morphogenetic protein (BMP)-mediated induction of cardiac-specific gene expression (PubMed:15329343). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (PubMed:15329343). May play a role in sphingolipid signaling by regulating the expression of sphingosine-1-phosphate degrading enzyme, spingosine-1-phosphate lyase (By similarity).

44.597 kDa

MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSGAASGATSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAAAAAAAAREAAAYSSSGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAASAGPFDSPVLHSLPGRANPARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPPGESLPPSSGASSNSSNATSSSSSSEEMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGSSIHPVLSALKLSPQGYPSPVTQTSQASSKQDSWNSLVLADSHGDIITA

gata4

Transcription factor GATA-4

392 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3'. Associated with cardiac specification and can regulate cardiac-specific transcription during embryogenesis. Activates the expression of cardiac MHC-alpha in vivo.

42.353 kDa

MYQSIAMATNHGPSGYEGTGSFMHSATAATSPVYVPTTRVSSMIHSLPYLQTSGSSQQGSPVSGHNMWAQAGVESSAYNPGTSHPPVSPRFTFSSSPPITAPSSREVSYSSPLGISANGREQYSRGLGATYASPYPAYMSPDMGAAWTASPFDSSMLHNLQNRAVTSRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLSKSKTLTGQSGSDSLTPSTSSTNSMGEEMRPIKIEPGLSPPYDHSNSISQASALSTITSHGSSYYPMPSLKLSPQNHHSTFNPSPQANSKHDSWNNLVLA

gata4

Transcription factor GATA-4

392 amino acids

Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3'. Associated with cardiac specification and can regulate cardiac-specific transcription during embryogenesis. Activates the expression of cardiac MHC-alpha in vivo.

42.353 kDa

MYQSIAMATNHGPSGYEGTGSFMHSATAATSPVYVPTTRVSSMIHSLPYLQTSGSSQQGSPVSGHNMWAQAGVESSAYNPGTSHPPVSPRFTFSSSPPITAPSSREVSYSSPLGISANGREQYSRGLGATYASPYPAYMSPDMGAAWTASPFDSSMLHNLQNRAVTSRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLSKSKTLTGQSGSDSLTPSTSSTNSMGEEMRPIKIEPGLSPPYDHSNSISQASALSTITSHGSSYYPMPSLKLSPQNHHSTFNPSPQANSKHDSWNNLVLA

GATA4

Transcription factor GATA-4

380 amino acids

Transcriptional activator. Binds to the consensus sequence 5'-AGATAG-3' (By similarity).

40.676 kDa

single

PVYVPTTRVPSMLPSLPYLPSSGSSQQASPVSSHSIWTQPGAESAAYNPGSSHPPVSPRFSFSTSTPIPSTSSRDAAAAYSSSLSLSANGREQYSRGFGSSYSSPYPAYVSPEMATTWTSSPFDSPMLHNLQSRGTPAAARHANIEFFDDYSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLFKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKTKTPAGPSSSESLTPTTSSTSSSSSATTTEEMRPIKTEPGLSSHYGHPSPISQAFSVSAMSGHGSSIHPAISALKLSPQAYQSAISQSPQASSKQDSWNSLVLAENHGDIITA

GATA4

Transcription factor GATA-4

380 amino acids

Transcriptional activator. Binds to the consensus sequence 5'-AGATAG-3' (By similarity).

40.676 kDa

single

PVYVPTTRVPSMLPSLPYLPSSGSSQQASPVSSHSIWTQPGAESAAYNPGSSHPPVSPRFSFSTSTPIPSTSSRDAAAAYSSSLSLSANGREQYSRGFGSSYSSPYPAYVSPEMATTWTSSPFDSPMLHNLQSRGTPAAARHANIEFFDDYSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLFKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKTKTPAGPSSSESLTPTTSSTSSSSSATTTEEMRPIKTEPGLSSHYGHPSPISQAFSVSAMSGHGSSIHPAISALKLSPQAYQSAISQSPQASSKQDSWNSLVLAENHGDIITA

GATA4

GATA transcription factor 4

240 amino acids

Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes.

Belongs to the type IV zinc-finger family. Class A subfamily.

26.467 kDa

MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLLTDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAPSVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ

GATA4

GATA transcription factor 4

240 amino acids

Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes.

Belongs to the type IV zinc-finger family. Class A subfamily.

26.467 kDa

MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLLTDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAPSVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ