Transcriptional activator that binds to the consensus sequence 5'-AGATAG-3'. Associated with cardiac specification and can regulate cardiac-specific transcription during embryogenesis. Activates the expression of cardiac MHC-alpha in vivo.

392 amino acids

MYQSIAMATNHGPSGYEGTGSFMHSATAATSPVYVPTTRVSSMIHSLPYLQTSGSSQQGSPVSGHNMWAQAGVESSAYNPGTSHPPVSPRFTFSSSPPITAPSSREVSYSSPLGISANGREQYSRGLGATYASPYPAYMSPDMGAAWTASPFDSSMLHNLQNRAVTSRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNLSKSKTLTGQSGSDSLTPSTSSTNSMGEEMRPIKIEPGLSPPYDHSNSISQASALSTITSHGSSYYPMPSLKLSPQNHHSTFNPSPQANSKHDSWNNLVLA

42.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make gata4 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here