Exd1

piRNA biogenesis protein EXD1

570 amino acids

RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity (PubMed:26669262). The PET complex is required during the secondary piRNAs metabolic process for the PIWIL2 slicing-triggered loading of PIWIL4 piRNAs. In the PET complex, EXD1 probably acts as an RNA adapter. EXD1 is an inactive exonuclease (By similarity).

Belongs to the EXD1 family.

63.962 kDa

MDPSSDYHFLNQILWRRVKLTLVSGIFEGVLQHVDPNKIVVLKNVRNAESGRSVPGVKVFFGHEILNVELMDEAEGASGEKASAVSINTERAGMEKVKNEDVNVCEPASPAPEVPTSSLLSDLKYCPSEEEEVTYTVIDQFQQKFGAAMLHIKKQSVLSVAAEGANVCRHGKLCWLQVATNSRVYLFDIFLLGSRAFNNGLQMILEDKRILKVIHDCRWLSDCLSHQYGIMLNNVFDTQVADVLQFSMETGGFLPNCISTLQESLIRHLKVAPRYLFFLEERQKRIQENPEIWLTRPLPPSLLKILALETTYLLPLRLVLLDEVMSDLTTLVDGYLNTYREGSADRLAGTEPACMELPAELLQLQDFQKQRRERAVKEYRVNARGLLIRTPLHPKEPTACTAGKEERVQGFLFYKTDGGDQVPRFLCPKSHEDEKFLDKESKQTTAKSQIVPPRKEGEAHKDSKNKPGCWESAGPEDPRAQKAHALPPTWASQSQFSLKEEIEQLTVVGNKGALTSPKEGALVSPSLLQETWEAPTDTFHLPEKAEVSTLPPCPALEKTDSWISPSLNLF

EXD1

piRNA biogenesis protein EXD1

514 amino acids

RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity (By similarity). The PET complex is required during the secondary piRNAs metabolic process for the PIWIL2 slicing-triggered loading of PIWIL4 piRNAs. In the PET complex, EXD1 probably acts as an RNA adapter. EXD1 is an inactive exonuclease (By similarity).

Belongs to the EXD1 family.

58.335 kDa

MEDSEFLAYVELLDEVEQGSVRAKASSVSLHAERTWMEKMKVEDLNVCEPASPAPEAPATSLLNDLKYSPSEEEEVTYTVINQFQQKFGAAILHIKKQNVLSVAAEGANVCRHGKLCWLQVATNCRVYLFDIFLLGSRAFHNGLQMILEDKRILKVIHDCRWLSDCLSHQYGILLNNVFDTQVADVLQFSMETGGYLPNCITTLQESLIKHLQVAPKYLSFLEKRQKLIQENPEVWFIRPVSPSLLKILALEATYLLPLRLALLDEMMSDLTTLVDGYLNTYREGSADRLGGTEPTCMELPEELLQLKDFQKQRREKAAREYRVNAQGLLIRTVLQPKKLVTETAGKEEKVKGFLFGKNFRIDKAPSFTSQDFHGDVNLLKEESLNKQATNPQHLPPTEEGETSEDSSNKLICTKSKGSEDQRITQKEHFMTPKHEFQASLSLKEETEQLLMVENKEDLKCTKQAVSMSSFPQETRVSPSDTFYPIRKTVVSTLPPCPALEKIDSWISPFLNLP

exd1

piRNA biogenesis protein EXD1

444 amino acids

RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity. The PET complex is required during the secondary piRNAs metabolic process for the piwil2 slicing-triggered loading of piwil4 piRNAs. In the PET complex, exd1 probably acts as an RNA adapter. Exd1 is an inactive exonuclease.

Belongs to the EXD1 family.

50.781 kDa

MLINKVKDLETGKIIPGAQLLFGYNILNVALQKDVEEVPAKHLDKLTIEDREQTSTEQRHADECNQDAERTHRDIDKSQDLRTRTLKVIKHSVDEEEVGYTIIDQFQPIFGPAIRHLQNQKVISIGAVGQNICRHGKLSWLQFATRSRVYLFDVLVLGSKVFKNGLQMVLEDKGILKVIHDCRWLGDILSHQYGIILNNVFDTQVGDVYLFSMETGGFLPHGTRTLEECLIHHLSMLPSKVSFLAHRQTLTKEYHDIWFDRPMDPTLLKLLSLEVTYLMPLRSAMLDAMFSDFTLLVDGYLNAYRRGTADILESPELSVAELPKELQQLRVLQQMRREKALKEYDVNNKGLLTRVEAEKAPRSEASGTKHDAELENVVKLTKSEKSFHQTMTTNAPLLENQTEKQQGALCQKFPVVPNCFPRGPFDYYLYKKWASNDTPTTNVS

exd1

piRNA biogenesis protein EXD1

378 amino acids

RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity. The PET complex is required during the secondary piRNAs metabolic process for the piwil2 slicing-triggered loading of piwil4 piRNAs. In the PET complex, exd1 probably acts as an RNA adapter. Exd1 is an inactive exonuclease.

Belongs to the EXD1 family.

42.794 kDa

MNNRLNTTSSSEESRFLEEMKRKRVNITLSDTEISGVIQKITQKKTLILEDVSEVRSGRRFPGAKLIFGKEIVKVEFPLSAGQASVFSNEKHKSEFQTFKKKMTLDGEEDGVSYVLIDELHEKFGPAVMHIQEQDVIGIGADVYGQSGQERLCWLQVATKKVVYLFDILLLGGPAFKNGLSMILENTHILKVLHDCRCITRCLRTEFRVQLTNVFDTQVAELLLFFNESGGFLPDRPASLPELLQLHLRLTTAEIQPLCSKQQQSRECVQLWYVRPCPPDLLSLMCSSVQHLLSLRLLLLDALLADYTVLVDSFMSSSHCPPLHFQQDECAVPPELQELMCVRQQRMDWASQCYSQTDSGLLQRSSFKASPHTPADAQ

EXD1

piRNA biogenesis protein EXD1

315 amino acids

RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity. The PET complex is required during the secondary piRNAs metabolic process for the PIWIL2 slicing-triggered loading of PIWIL4 piRNAs. In the PET complex, EXD1 probably acts as an RNA adapter. EXD1 is an inactive exonuclease.

Belongs to the EXD1 family.

36.486 kDa

MDNLYTKGELLQVHTKNYDVFEGRFYSMAQDKTKISLYDVKEIPHGDANDGVLHYYDSEIREVVKLQESTEKKVLKISQTKYEEILKISKKYIFINQVDKSFHEAVDDLNQQDFIAVSGDGANMGRKCKMPFLVLSTDHQIYIFDIQVMQYHAFESGLKKILEGDSPKKIAHDCRKLSDCLYHKHNVKLKSVFDTQVGDLIITKNKKVTLPNKVKSLGECLTNYLGLQQNTIDEKLDIVQSTERPLSVKIKDSLARNIAFLHHLSEVINEEMQLPFYRGVECYIENIRSSDDFKAWELCGKLNQIPKEFRNAIDY