Description
RNA-binding component of the PET complex, a multiprotein complex required for the processing of piRNAs during spermatogenesis. The piRNA metabolic process mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposable elements, preventing their mobilization, which is essential for the germline integrity. The PET complex is required during the secondary piRNAs metabolic process for the piwil2 slicing-triggered loading of piwil4 piRNAs. In the PET complex, exd1 probably acts as an RNA adapter. Exd1 is an inactive exonuclease.
Family
Belongs to the EXD1 family.
Sequence
MLINKVKDLETGKIIPGAQLLFGYNILNVALQKDVEEVPAKHLDKLTIEDREQTSTEQRHADECNQDAERTHRDIDKSQDLRTRTLKVIKHSVDEEEVGYTIIDQFQPIFGPAIRHLQNQKVISIGAVGQNICRHGKLSWLQFATRSRVYLFDVLVLGSKVFKNGLQMVLEDKGILKVIHDCRWLGDILSHQYGIILNNVFDTQVGDVYLFSMETGGFLPHGTRTLEECLIHHLSMLPSKVSFLAHRQTLTKEYHDIWFDRPMDPTLLKLLSLEVTYLMPLRSAMLDAMFSDFTLLVDGYLNAYRRGTADILESPELSVAELPKELQQLRVLQQMRREKALKEYDVNNKGLLTRVEAEKAPRSEASGTKHDAELENVVKLTKSEKSFHQTMTTNAPLLENQTEKQQGALCQKFPVVPNCFPRGPFDYYLYKKWASNDTPTTNVS
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service