E8R

Protein E8

273 amino acids

Early protein packaged into virion cores. May play a role in the biogenesis of the viral factories by recruiting and wrapping these DNA replication sites in endoplasmic reticulum derived membranes. Later in infection, phosphorylation of E8R by the late viral kinase F10L might decrease E8R DNA-binding ability and trigger ER membranes disassembly. Binds DNA in vitro (By similarity).

Belongs to the chordopoxvirinae E8 family.

31.936 kDa

MAATVPRFDDVYKNAQRRILDQETFFSRGLSRPLMKNTYLFDNYAYGWIPETAIWSSRYANLDASDYYPISLGLLKKFEFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSALPTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYKPLFSRLKENYIFTGPVPICIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLLFYVPGYSITTKITPAVEYLMDKLNLTKSDVQLL

E8R

Protein E8

273 amino acids

Early protein packaged into virion cores. May play a role in the biogenesis of the viral factories by recruiting and wrapping these DNA replication sites in endoplasmic reticulum derived membranes. Later in infection, phosphorylation of E8R by the late viral kinase F10L might decrease E8R DNA-binding ability and trigger ER membranes disassembly. Binds DNA in vitro (By similarity).

Belongs to the chordopoxvirinae E8 family.

31.898 kDa

MAAVVPRFDDVYKNAQRRILDQETFFSRGLGRPLMKNTYLFDNYAYGWIPETAIWSSRYANLDASDYYPISLGLLKKFKFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSALPTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYKPLFSRLKENYIFTGPVPIGIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLLFYVPGYSITTKITPAVEYLMDKLKLTKNDVQLL