Early protein packaged into virion cores. May play a role in the biogenesis of the viral factories by recruiting and wrapping these DNA replication sites in endoplasmic reticulum derived membranes. Later in infection, phosphorylation of E8R by the late viral kinase F10L might decrease E8R DNA-binding ability and trigger ER membranes disassembly. Binds DNA in vitro (By similarity).

Belongs to the chordopoxvirinae E8 family.

273 amino acids

MAAVVPRFDDVYKNAQRRILDQETFFSRGLGRPLMKNTYLFDNYAYGWIPETAIWSSRYANLDASDYYPISLGLLKKFKFLMSLYKGPIPVYEEKVNTEFIANGSFSGRYVSYLRKFSALPTNEFISFLLLTSIPIYNILFWFKNTQFDITKHTLFRYVYTDNAKHLALARYMHQTGDYKPLFSRLKENYIFTGPVPIGIKDIDHPNLSRARSPSDYETLANISTILYFTKYDPVLMFLLFYVPGYSITTKITPAVEYLMDKLKLTKNDVQLL

31.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make E8R using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here