draxin

Draxin

360 amino acids

Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord.

Belongs to the draxin family.

40.085 kDa

MVAPGLCQLFILLLITLSHTSHSSEISSDHFKQSLTTSTTTSKEHPETGLTGGRQQKRHWSGKERDSAGLFSQRHMDRLEDDGTSMEGLSPVRLEMGPGDTMKAEVHGEVRASAQMRQGSHPAEGELNRKGRRHSHRLLAEHRKHGGKKDKGRGKGDLSDPEPELDSLLKDLNAFEDGLNTSPPNYNSVPLNEVPSPLSPILVTTAIKGHPPTLPPASTKPQKSSQGRTQGEVMPTLDMTLFDWTDYEDMKPADSWPSNKRKDKRRSKNKSNGNTTTEAGIVEPCDHHLDCLSGSCCDLREFECKPHNRGLNNKCFDDCMCEEGLRCYAKFHRKRRVTRRRGRCVDPESVNSNQGAFITV

DRAXIN

Draxin

349 amino acids

Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord and cortical explants in vitro. Binds directly to the neurites and growth cones.

Belongs to the draxin family.

39.119 kDa

MAASSTFFSPSLFLCVLVLIDITLAVSLDTDMKLKSENNNHLQNQETWPQQPRSGHHHKHGLAKKGRVLALPVRGQPAGEEALRVGSGAPAMEELVPLGQPAALKQDKDKDVFLGFELPHAERENQSPGSERGKKQNREQRRHSRRDRLKHHRGKTAVGPSSLYKKPESFEQQFQNLQAEEATSPTPTVLPFTALDLVVSTEEPPVLPATSPRSQARLRQDGDVMPTLDMALFDWTDYEDLKPEMWPSAKKKEKRRSKSSNGGNETSSAEGEPCDHHLDCLPGSCCDLREHLCKPHNRGLNNKCYDDCMCTEGLRCYAKFHRNRRVTRRKGRCVEPESANGEQGSFINV

DRAXIN

Draxin

349 amino acids

Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.

Belongs to the draxin family.

38.65 kDa

MAGPAIHTAPMLFLVLLLPLELSLAGALAPGTPARNLPENHIDLPGPALWTPQASHHRRRGPGKKEWGPGLPSQAQDGAVVTATRQASRLPEAEGLLPEQSPAGLLQDKDLLLGLALPYPEKENRPPGWERTRKRSREHKRRRDRLRLHQGRALVRGPSSLMKKAELSEAQVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV

Draxin

Draxin

343 amino acids

Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.

Belongs to the draxin family.

38.363 kDa

MAGCPVLRVPTLFLILLLFPELHTAGTLASGSSARNLPETHSHLPSSALWVSQASHHGRRGLGKKDRGPGRPSRAQEGAVVTATKQASQMTLGQPPAGLLQNKELLLGLTLPYPEKEARSPAWERVKKRGREHKRRRDRLRLHRGRAAIRGPSSLMKKVEPSEDRMLEGTMEESSTSLAPTMFFLTMTDGATPTTEESRILPVTSLRPQTQPRSDGEVMPTLDMALFDWTDYEDLKPEVWPSAKKKEKHWSHFTSDGNETSPAEGDPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINI

DRAXIN

Draxin

337 amino acids

Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord. Inhibits the stabilization of cytosolic beta-catenin (CTNNB1) via its interaction with LRP6, thereby acting as an antagonist of Wnt signaling pathway.

Belongs to the draxin family.

37.314 kDa

MLLLALLLLLELSLAGSLGPGSSAQNLPENHIDLSGPALWTPQASHHRRRGLGKKERGPGTPGWTQDGAVVTATRQASRLPGAEGLLHGSSPAGLLQDKGLLRGLTRPYPEKETQAPGSERVKKRGREHKRRKERLRLHRGRALVRGPSSLMKKAELSEDQSPDALMEESSTSLAPTILYLTTFEAPATEESLILPVTSLWPQAHPRPDGEVMPTLDMALFDWTDYEDLKPEVWPSTRKKEKHRGKLSSDGNETSPAKGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV