Description
Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord and cortical explants in vitro. Binds directly to the neurites and growth cones.
Family
Belongs to the draxin family.
Sequence
MAASSTFFSPSLFLCVLVLIDITLAVSLDTDMKLKSENNNHLQNQETWPQQPRSGHHHKHGLAKKGRVLALPVRGQPAGEEALRVGSGAPAMEELVPLGQPAALKQDKDKDVFLGFELPHAERENQSPGSERGKKQNREQRRHSRRDRLKHHRGKTAVGPSSLYKKPESFEQQFQNLQAEEATSPTPTVLPFTALDLVVSTEEPPVLPATSPRSQARLRQDGDVMPTLDMALFDWTDYEDLKPEMWPSAKKKEKRRSKSSNGGNETSSAEGEPCDHHLDCLPGSCCDLREHLCKPHNRGLNNKCYDDCMCTEGLRCYAKFHRNRRVTRRKGRCVEPESANGEQGSFINV
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service