Chemorepulsive axon guidance protein required for the development of spinal cord and forebrain commissures. Acts as a chemorepulsive guidance protein for commissural axons during development. Able to inhibit or repel neurite outgrowth from dorsal spinal cord and cortical explants in vitro. Binds directly to the neurites and growth cones.

Belongs to the draxin family.

349 amino acids

MAASSTFFSPSLFLCVLVLIDITLAVSLDTDMKLKSENNNHLQNQETWPQQPRSGHHHKHGLAKKGRVLALPVRGQPAGEEALRVGSGAPAMEELVPLGQPAALKQDKDKDVFLGFELPHAERENQSPGSERGKKQNREQRRHSRRDRLKHHRGKTAVGPSSLYKKPESFEQQFQNLQAEEATSPTPTVLPFTALDLVVSTEEPPVLPATSPRSQARLRQDGDVMPTLDMALFDWTDYEDLKPEMWPSAKKKEKRRSKSSNGGNETSSAEGEPCDHHLDCLPGSCCDLREHLCKPHNRGLNNKCYDDCMCTEGLRCYAKFHRNRRVTRRKGRCVEPESANGEQGSFINV

39.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make DRAXIN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here