DIG1

Down-regulator of invasive growth 1

452 amino acids

DIG1 and DIG2 are negative regulators of the filamentation and pheromone induced mating program. DIG1 and DIG2 inhibit the transcriptional activity of STE12 by direct protein-protein interaction. DIG1 colocalizes to promoters with STE12 and redistributes with it during induction of filamentation (by butanol) or mating (by pheromone) to program specific genes, but binding of DIG1 to STE12 is reduced by pheromone treatment.

49.356 kDa

MAVSARLRTTAEDTSIAKSTQDPIGDTEISVANAKGSSDSNIKNSPGGNSVGQESELEHVPEEDDSGDKEADHEDSETATAKKRKAQPLKNPKKSLKRGRVPAPLNLSDSNTNTHGGNIKDGNLASSNSAHFPPVANQNVKSAPAQVTQHSKFQPRVQYLGKASSRQSIQVNNSSNSYGKPHMPSAGIMSAMNPYMPMNRYIMSPYYNPYGIPPPHMLNKPIMTPYVSYPYPMGPRTSIPYAMQGGNARPYEENEYSASNYRNKRVNDSYDSPLSGTASTGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTSTSTSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVPTPTFTTFQRTSQPQQQSPSLLQGEIRLSSHIFAFEFPLSSSNVDKKMFMSICNKVWNESKELTKKSSSHHRTGK