Description
DIG1 and DIG2 are negative regulators of the filamentation and pheromone induced mating program. DIG1 and DIG2 inhibit the transcriptional activity of STE12 by direct protein-protein interaction. DIG1 colocalizes to promoters with STE12 and redistributes with it during induction of filamentation (by butanol) or mating (by pheromone) to program specific genes, but binding of DIG1 to STE12 is reduced by pheromone treatment.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Sequence
MAVSARLRTTAEDTSIAKSTQDPIGDTEISVANAKGSSDSNIKNSPGGNSVGQESELEHVPEEDDSGDKEADHEDSETATAKKRKAQPLKNPKKSLKRGRVPAPLNLSDSNTNTHGGNIKDGNLASSNSAHFPPVANQNVKSAPAQVTQHSKFQPRVQYLGKASSRQSIQVNNSSNSYGKPHMPSAGIMSAMNPYMPMNRYIMSPYYNPYGIPPPHMLNKPIMTPYVSYPYPMGPRTSIPYAMQGGNARPYEENEYSASNYRNKRVNDSYDSPLSGTASTGKTRRSEEGSRNSSVGSSANAGPTQQRADLRPADMIPAEEYHFERDALLSANTKARSASTSTSTSTSTNRDRSSWHEAEPNKDEEEGTDLAIEDGAVPTPTFTTFQRTSQPQQQSPSLLQGEIRLSSHIFAFEFPLSSSNVDKKMFMSICNKVWNESKELTKKSSSHHRTGK
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service