CTH

Cystathionine gamma-lyase

405 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (By similarity).

Belongs to the trans-sulfuration enzymes family.

44.406 kDa

MQEKEASPHGFLPRFQHFATQAIHVGQEPEQWTSQAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYSLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVATEFGLKISFVDCSKPKLLEAAITPETKLVWIETPTNPSLKMIDIEACAHTVHKHGDIILVVDNTFMSAYFQRPLSLGADICMYSATKYMNGYSDVVMGLVSLNSESLHDRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESNPQVEKVIYPGLPSHPQHELAKRQCTGCPGMVTFYIKGSLQHAETFLQNLKLFTLAESLGGYESLAELPAIMTHASVPKSDREVLGISDTLIRLSVGLEDKQDLLDDLDQALKAANPPNASSN

CTH

Cystathionine gamma-lyase

405 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function.

Belongs to the trans-sulfuration enzymes family.

44.508 kDa

MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS

CTH

Cystathionine gamma-lyase

405 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (By similarity).

Belongs to the trans-sulfuration enzymes family.

44.521 kDa

MQEKDASSQGFLPHFQHFATQAIHVGQEPEQWTSRAVVPLISLSTTFKQAAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPVLKMIDIEACAHIVHKRGDIILVVDNTFMSPYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNCERLHNRLRFLQNSLGAVPSPLDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPGVEKVIYPGLPSHPQHELAKRQCTGCTGMITFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLVELPAIMTHASVPKNDRDVLGISDTLIRLSVGLEDEKDLLEDLDQALKAAHPPSGSHD

CTH

Cystathionine gamma-lyase

405 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (By similarity).

Belongs to the trans-sulfuration enzymes family.

44.49 kDa

MQEKDVSSHGFLPRFQHFATQAIHAGQEPEQWASKAVVPPISLSTTFKQEAPGQHSGFEYSRSGNPTXNCLEKAVAVLDGAKYSLAFASGLAATVTITHLLKAGXQIISMDDVYGGTNRYFRQVAAEFGLKISFVDCSKSKLLEAAITPETKLVWIETPTNPILKMIDIEACAQIVHKHGDIILVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSLNSETLHSRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYPGLPSHPQHELAKRQCTGCPGMISFYIKGSLHHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLGIRDTLIRLSVGLEDKQDLMDDLDQALKAAHPTNASHN

Cth

Cystathionine gamma-lyase

398 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function.

Belongs to the trans-sulfuration enzymes family.

43.567 kDa

MQKDASLSGFLPSFQHFATQAIHVGQEPEQWNSRAVVLPISLATTFKQDFPGQSSGFEYSRSGNPTRNCLEKAVAALDGAKHSLAFASGLAATITITHLLKAGDEIICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIGACAQIVHKRGDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVNSDDLNSRLRFLQNSLGAVPSPFDCYLCCRGLKTLQVRMEKHFKNGMAVARFLETNPRVEKVVYPGLPSHPQHELAKRQCSGCPGMVSFYIKGALQHAKAFLKNLKLFTLAESLGGYESLAELPAIMTHASVPEKDRATLGINDTLIRLSVGLEDEQDLLEDLDRALKAAHP

Cth

Cystathionine gamma-lyase

398 amino acids

Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (By similarity).

Belongs to the trans-sulfuration enzymes family.

43.605 kDa

MQKDASSSGFLPSFQHFATQAIHVGPEPEQWSSRAVVLPISLATTFKQDSPGQSSGFVYSRSGNPTRNCLEKAVAALDGAKHCLTFARGLAATTTITHLLKAGDEVICMDEVYGGTNRYFRRVASEFGLKISFVDCSKTKLLEAAITPQTKLVWIETPTNPTLKLADIKACAQIVHKHKDIILVVDNTFMSAYFQRPLALGADICMCSATKYMNGHSDVVMGLVSVTSDDLNERLRFLQNSLGAVPSPFDCYLCCRGLKTLQIRMEKHFRNGMAVARFLESNPRVEKVIYPGLPSHPQHELAKRQCTGCPGMVSFYIKGTLQHAQVFLKNIKLFALAESLGGYESLAELPAIMTHASVPEKDRATLGISDTLIRLSVGLEDEKDLLEDLGQALKAAHP