Catalyzes the last step in the trans-sulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure. Acts as a cysteine-protein sulfhydrase by mediating sulfhydration of target proteins: sulfhydration consists of converting -SH groups into -SSH on specific cysteine residues of target proteins such as GAPDH, PTPN1 and NF-kappa-B subunit RELA, thereby regulating their function (By similarity).

Belongs to the trans-sulfuration enzymes family.

405 amino acids

MQEKDVSSHGFLPRFQHFATQAIHAGQEPEQWASKAVVPPISLSTTFKQEAPGQHSGFEYSRSGNPTXNCLEKAVAVLDGAKYSLAFASGLAATVTITHLLKAGXQIISMDDVYGGTNRYFRQVAAEFGLKISFVDCSKSKLLEAAITPETKLVWIETPTNPILKMIDIEACAQIVHKHGDIILVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLVSLNSETLHSRLRFLQNSLGAVPSPIDCYLCNRGLKTLQVRMEKHFENGMAVAQFLESHPLVEKVIYPGLPSHPQHELAKRQCTGCPGMISFYIKGSLHHAETFLKSLKLFTLAESLGGYESLAELPAIMTHSSVPKSDREVLGIRDTLIRLSVGLEDKQDLMDDLDQALKAAHPTNASHN

44.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CTH using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here