cskmt

Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial

254 amino acids

Protein-lysine methyltransferase that selectively trimethylates citrate synthase (CS) in mitochondria. Seems to conduct trimethylation in a highly distributive manner rather than in a processive manner, and thus introduces a single methly group per binding event.

Belongs to the methyltransferase superfamily.

28.331 kDa

MLLNRFLVPLRSLQKLTQARRWHQTSLINDLVVNMDKKAMWDRFYTENGSKGQFKNFEWFFGFPSVKDLVLPALQAMSCSHSGPLHILDMGCGTSALGPCIYSTSPCAVRVTCADISPVAVKLMEEHTKSTSTQPCNPSSALVFLELDCTQMTGHFKSRSLDLILDKGTTDALVRSKEGQVKAGQILRQSLQVLRPSGSFLQFSDEDPDARLIWLEREVQGAEVTADVGVQEIGELRGVSYFCYQISPRSRPHS

CSKMT

Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial

240 amino acids

Protein-lysine methyltransferase that selectively trimethylates citrate synthase (CS) in mitochondria (PubMed:28391595, PubMed:28887308). Seems to conduct trimethylation in a highly distributive manner rather than in a processive manner, and thus introduces a single methly group per binding event (PubMed:28887308).

Belongs to the methyltransferase superfamily.

25.91 kDa

MAALRRMLHLPSLMMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYDEVQGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLDKGTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAYLIQGSH

CSKMT

Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial

240 amino acids

Protein-lysine methyltransferase that selectively trimethylates citrate synthase (CS) in mitochondria. Seems to conduct trimethylation in a highly distributive manner rather than in a processive manner, and thus introduces a single methly group per binding event.

Belongs to the methyltransferase superfamily.

25.956 kDa

MAALRRMLHLPRLTMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYEEVQGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADARNLGAVASSGSFQLLLDKGTWDAVAQGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSRGWTVTVQELGPFRGITYFAYLIQGSH