Protein-lysine methyltransferase that selectively trimethylates citrate synthase (CS) in mitochondria. Seems to conduct trimethylation in a highly distributive manner rather than in a processive manner, and thus introduces a single methly group per binding event.

Belongs to the methyltransferase superfamily.

240 amino acids

MAALRRMLHLPRLTMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYEEVQGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADARNLGAVASSGSFQLLLDKGTWDAVAQGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSRGWTVTVQELGPFRGITYFAYLIQGSH

26 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CSKMT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here