CCNA2

Cyclin-A2

432 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

48.551 kDa

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

CCNA2

Cyclin-A2

432 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

48.551 kDa

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL

CCNA2

Cyclin-A2

430 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

48.262 kDa

MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGPAPQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV

CCNA2

Cyclin-A2

430 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

48.262 kDa

MLGSSAHGPAAREAGSAVTLQQTAFQEDQENVNPEKAAPAQQPRTRAGLAVLRAGNSRGPAPQRPKTRRVAPLKDLPINDEYVPVPPWKANNKQPAFTIHVDEAEEEIQKRPTESKKSESEDVLAFNSAVTLPGPRKPLAPLDYPMDGSFESPHTMEMSVVLEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV

Ccna2

Cyclin-A2

422 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

47.269 kDa

MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV

Ccna2

Cyclin-A2

422 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

47.269 kDa

MPGTSRHSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKAGNVRGPAPQQKLKTRRVAPLKDLPINDEHVTAGPSWKAVSKQPAFTIHVDEAEETQKRPAELKETECEDALAFNAAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDKPVNVNEVPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLAQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPETLSV

CCNA2

Cyclin-A2

421 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

47.327 kDa

MPGSSRQSGREAGSALLSLQQEDQENVNPEKAAPDQRARAALKTGNARGNAPQQRLKARRVAPLKDLSINDEHVASGPSWKAASKQPAFTIHVDEEEDTQKIPPEHKEMRCEDALAFNAAVSLPGARKPLVPLDYPMDGSFESPHAMDMSIVLEEEKPVSVNEVPDYHEDIHTYLREMEIKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLNQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAAQHTQQSIREKYKHSKYHGVSLLNPPETLNV

CCNA2

Cyclin-A2

421 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

47.327 kDa

MPGSSRQSGREAGSALLSLQQEDQENVNPEKAAPDQRARAALKTGNARGNAPQQRLKARRVAPLKDLSINDEHVASGPSWKAASKQPAFTIHVDEEEDTQKIPPEHKEMRCEDALAFNAAVSLPGARKPLVPLDYPMDGSFESPHAMDMSIVLEEEKPVSVNEVPDYHEDIHTYLREMEIKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLNQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTGQSWPESLVQKTGYTLESLKPCLMDLHQTYLRAAQHTQQSIREKYKHSKYHGVSLLNPPETLNV

ccna2

Cyclin-A2

415 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

46.67 kDa

MSDHLLRDEHQENVQPRKLLVPVGGRTVLGVLQENHRGPKALKVSKPALQQTQVLSVNHLGVNDENYGKIPARKAASKQPAFTIHVDEPDCATNKRKAVHKKTVQDENLQQLNSVLGSIGTRKPLHPIQIAMETSFGSPMDVSIVDEEQKVVGCNNVADYAKEIHTYLREMEVKCKPKAGYMQKQPDITGNMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLKMEHLVLKVLSFDLAAPTILQYLNQYFQIHPVSPKVESLSMFLGELSLVDADPFLRYLPSVVAAAAFVIANCTINERTWSDPLVEYTSYTLETLKPCILDLYQTYLSAASHQQQAVREKYKAPKNHAVSLIIPPESMSTFL

ccna2

Cyclin-A2

415 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

46.67 kDa

MSDHLLRDEHQENVQPRKLLVPVGGRTVLGVLQENHRGPKALKVSKPALQQTQVLSVNHLGVNDENYGKIPARKAASKQPAFTIHVDEPDCATNKRKAVHKKTVQDENLQQLNSVLGSIGTRKPLHPIQIAMETSFGSPMDVSIVDEEQKVVGCNNVADYAKEIHTYLREMEVKCKPKAGYMQKQPDITGNMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLKMEHLVLKVLSFDLAAPTILQYLNQYFQIHPVSPKVESLSMFLGELSLVDADPFLRYLPSVVAAAAFVIANCTINERTWSDPLVEYTSYTLETLKPCILDLYQTYLSAASHQQQAVREKYKAPKNHAVSLIIPPESMSTFL

CCNA2

Cyclin-A2

395 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

44.08 kDa

MLAEQENQENVPPAAKAPPPAAGTRVALGLLRGGPARPGPAAQAARNGEGRGAAAGQQQQPFSVYVDEPDEERRRPQRKKERDEEAADAPGLRAALGTVGERRPLAPLGNAMELSLDSPSIMDISITSEAEERPNVNNVPDYVSDIHTYLREMEVKCKPKIGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYNKKQVLRMEHLILKVLSFDLAAPTINQFLTQYFLHQQTNAKVESLSMYLGELTLIDADPYLKYLPSVIAAAAFHLASYTITGQTWPESLCKVTGYTLEHIKPCLMDLHRTYLKAAQHTQQSIREKYKSTKYHAVSLIDAPETLDL

CCNA2

Cyclin-A2

395 amino acids

Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.

Belongs to the cyclin family. Cyclin AB subfamily.

44.08 kDa

MLAEQENQENVPPAAKAPPPAAGTRVALGLLRGGPARPGPAAQAARNGEGRGAAAGQQQQPFSVYVDEPDEERRRPQRKKERDEEAADAPGLRAALGTVGERRPLAPLGNAMELSLDSPSIMDISITSEAEERPNVNNVPDYVSDIHTYLREMEVKCKPKIGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYNKKQVLRMEHLILKVLSFDLAAPTINQFLTQYFLHQQTNAKVESLSMYLGELTLIDADPYLKYLPSVIAAAAFHLASYTITGQTWPESLCKVTGYTLEHIKPCLMDLHRTYLKAAQHTQQSIREKYKSTKYHAVSLIDAPETLDL