About Products Protein Database Contact

Protein expression services for CCNA2 | Cyclin-A2

Description
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 and CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Family
Belongs to the cyclin family. Cyclin AB subfamily.
Species
Gallus gallus
Length
395 amino acids
Sequence
MLAEQENQENVPPAAKAPPPAAGTRVALGLLRGGPARPGPAAQAARNGEGRGAAAGQQQQPFSVYVDEPDEERRRPQRKKERDEEAADAPGLRAALGTVGERRPLAPLGNAMELSLDSPSIMDISITSEAEERPNVNNVPDYVSDIHTYLREMEVKCKPKIGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYNKKQVLRMEHLILKVLSFDLAAPTINQFLTQYFLHQQTNAKVESLSMYLGELTLIDADPYLKYLPSVIAAAAFHLASYTITGQTWPESLCKVTGYTLEHIKPCLMDLHRTYLKAAQHTQQSIREKYKSTKYHAVSLIDAPETLDL
Mass
44.1 kDa
Simulated SDS-PAGE
Western blot of CCNA2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make CCNA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here