CCL23

C-C motif chemokine 23

120 amino acids

Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1. CCL23(19-99), CCL23(22-99), CCL23(27-99), CCL23(30-99) are more potent chemoattractants than the small-inducible cytokine A23.

Belongs to the intercrine beta (chemokine CC) family.

13.411 kDa

MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN

CCL23

C-C motif chemokine 23

120 amino acids

Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

12.932 kDa

MKVSVAALSCLMLVTALGSQAQVTNDAETGFMMSKLSLANSEVLDSFHAINADCCTSYIPGSIPCSLLESYLETSSKCPKPGVIFLTKNGRRLCVSPSNKQVLACRIMLKLATRIKTRKN