Shows chemotactic activity for monocytes, resting T-lymphocytes, and neutrophils, but not for activated lymphocytes. Inhibits proliferation of myeloid progenitor cells in colony formation assays. This protein can bind heparin. Binds CCR1 (By similarity).

Belongs to the intercrine beta (chemokine CC) family.

120 amino acids

MKVSVAALSCLMLVTALGSQAQVTNDAETGFMMSKLSLANSEVLDSFHAINADCCTSYIPGSIPCSLLESYLETSSKCPKPGVIFLTKNGRRLCVSPSNKQVLACRIMLKLATRIKTRKN

12.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CCL23 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here