CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.191 kDa

MGLETEKTDVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHQLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIVAPLCTSIGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.253 kDa

MGLETEKADVQLFMDDDSYSHHSGVDYGDPEKFVDSGQDRDPHRLNSHLKVGFEDVIAEPMNMHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFTAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWRSVTDVIIAPLCTSIGRICSSVSLQVSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.255 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPLWLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIISPLCMSIGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.16 kDa

MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSIGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.231 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFVDSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

17.931 kDa

MGLETEKADVQLCMDDDAYSRHSAVDFGDLEQLADSGSDRDPRRLNSHLQVGFEDVIAEPVSTHSFDKVWICSHALFEVSKYVIYKFLTLLLAMPMAFAAGVLFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAVIAPLCSSVGRSFSSVSLQVSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.185 kDa

MGLETEKADVQLFMDDDSYSHHSCVDYADPEKFADSGRDRDPNRLNSNLQVGFEDVIAEPESTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFAAGIIFATLSCLHIWIIMPFVKTCLMVLPSVQTIWRSVTDAVIAPLCTSVGRVFSSVSLQLSRD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.251 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVFIAPLCTSVGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.251 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVFIAPLCTSVGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.071 kDa

MGLETEKADVQLFVDDDVYSRHSGVDYGDSEKFTDLGVDRDPRRLNSHLQLGFEDVIAEPVSTHSLDKVWICSHALFEISKYIIYKFLTVFLAIPLAFAAGILFATLSCLHIWITMPFVKTCLMVLPSVQTIWKSVTDVAIAPLCTSVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.141 kDa

MGLETEKADAQIYMDEDSYSRHSGLGYPEPEKCAKSTQDRDPRGLNTHLKMGFEDVIGEPESTHSFDKVWICSHALFEVSKYLIYKVLTVLLAIPLAFVAGILFATLSCLHIWIVVPFVKTCLMVLPSVQTVWHSITDGFIAPLYKSMGLIFSSISLRLSPE

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.134 kDa

MGLESEKADVQLFMDDDAYSRHSGVDFVEAEKFSASGPDRDPHRLNSHLQLGFQDVIAEPETTHSFDKVWICSHALFEISKYVLYKFLTFFLAIPLAFAAGILFAILSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

17.966 kDa

MGLETEKADVQLFMDDDSYSRHSGVDYADPEKFADAGGDRDPNQLNSHLKVGFEDVIAEPESTHSLDKVWICSHALFEVSKYVIYKFLTLFLAIPLAFAAGILFATLSCLHIWIVMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCASVGRSFSSVSMQLSRD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.256 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFVDSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLSIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.146 kDa

MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD

cav2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity).

Belongs to the caveolin family.

18.236 kDa

MGLEKEKLECSIIMDEDEFNRSIEPILSKKARLYSSAPDRDPHDINAQLKVGFEDVIAEPASAHSFDRVWIGSSATFELVKFIFYRLLTTLLAVPAAFILGVVFGVLSCIHIWLVMPVTRSFLMLLPSIQVVWKSVTDMFITPLFHSMGRSLSSIQVRTSDT

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

17.966 kDa

MGLETEKADVQLFMDDDSYSRHSGVDYADPEKFADAGGDRDPNQLNSHLKVGFEDVIAEPESTHSLDKVWICSHALFEVSKYVIYKFLTLFLAIPLAFAAGILFATLSCLHIWIVMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCASVGRSFSSVSMQLSRD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.256 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFVDSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLSIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.146 kDa

MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD

cav2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity).

Belongs to the caveolin family.

18.236 kDa

MGLEKEKLECSIIMDEDEFNRSIEPILSKKARLYSSAPDRDPHDINAQLKVGFEDVIAEPASAHSFDRVWIGSSATFELVKFIFYRLLTTLLAVPAAFILGVVFGVLSCIHIWLVMPVTRSFLMLLPSIQVVWKSVTDMFITPLFHSMGRSLSSIQVRTSDT

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.129 kDa

MGLETEKADVQLFLDDDSYSHHGDVDYADPEKFADSGHDRDPHRLNSHLKVGFEDVIAEPMTTHSCDKVWICSHALFEISKYVMYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSLSSISLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.065 kDa

MGLETEKADVQLFMDDDSYSRHSGVDYADPDKFADSGSDRDPHRLNSNLKVGFEDVIAEPVSTHSFDKVWICSHALFEISKYVIYKFLTLFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSITDVVIAPLCTSVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.233 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.094 kDa

MGLETEKADVQLFLDDESYSRHSGVDYADPEKFADAGLDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFVAGILFATLSCLHIWIIMPFVKTCLMLLPSVQTIWKSVTDVVIAPLCTSAGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.291 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

17.952 kDa

MGLETEKADVQLFMDDDAYSRHSGVDYADPEKFGGSGPDRDPHRLNSHLQLGFEDVVAEPVSTHSFDKVWICSHALFEISKYVVYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTVWKTVTDVVIAPLCASVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Caveolin-2 may function as an accessory protein in conjunction with caveolin-1 (By similarity).

Belongs to the caveolin family.

18.233 kDa

MGLETEKADVQLFLDDDSYSHHGDVDFADPEKFADSDHDRDPHRLNSHLKVGFEDVIAEPMTTHSCDKVWICSHALFEISKYVMYKFLTVFLAIPLAFVAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSISLQLSHD

Cav2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.227 kDa

MGLETEKADVQLFMADDAYSHHSGVDYADPEKYVDSSHDRDPHQLNSHLKLGFEDLIAEPETTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRSFSSVSMQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.146 kDa

MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Caveolin-2 may function as an accessory protein in conjunction with caveolin-1 (By similarity).

Belongs to the caveolin family.

18.146 kDa

MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEPVSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.194 kDa

MGLETEKADVQLFMDDDAYSRHSGVDYADLDKFADSGSDRDPHRLNSHLKVGFEDVIAEPVTTHSFDKVWICSHALFEISKYVIYKFLTFFLAIPMAFAAGILFAILSCLHIWIIMPFVKTCLMVLPSVQTIWKTITDVVIAPLCTSVGRSFSSISLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.065 kDa

MGLETEKADVQLFMDDDSYSRHSGVDYADPDKFADSGSDRDPHRLNSNLKVGFEDVIAEPVSTHSFDKVWICSHALFEISKYVIYKFLTLFLAIPLAFAAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSITDVVIAPLCTSVGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.19 kDa

MGLETEKADVQLFMDDDSYSHHSGVDYGDPEKFVDSGQDRDPHRLNSQLKVGFEDVIAEPVTTHSFDKVWICSHALFEISKYVLYKFLTVFLAIPLAFVAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSISLRLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.291 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.265 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVFIAPLCTSIGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.056 kDa

MGLETEKADVQLFMDDDSYSRHSGVDYADPKKFVDPGTDRDPHRLNSNLKVGFEDVIAEPVSTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIIPFVKTCLMVLPSVQTIWKSVTDVVIAPLCTSAGRSFSSVSLQLSHD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.189 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVVAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFLAGILFATLSCLHIWIIMPFVKTCLMVLPSVQTIWKSVTDAIIAPLCTSIGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

18.217 kDa

MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSGQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRSFSSVSLQLSQD

CAV2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression (By similarity).

Belongs to the caveolin family.

17.968 kDa

MGLETEKADVQLFMDDDAYSHHSGVDFADPEKFPDTGPDRDPHGLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVLYKFLTVFLAIPLAFAAGVLFAVLSCLHIWILMPFVKTCLMVLPSVQTIWRSVTDVVIAPLCASIGRSFSSVGLQLSHD

Cav2

Caveolin-2

162 amino acids

May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. The Ser-36 phosphorylated form has a role in modulating mitosis in endothelial cells. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression.

Belongs to the caveolin family.

18.266 kDa

MGLETEKADVQLFMADDAYSHHSVVDYTDPEKYVDSSQDRDPHQLNSHLKLGFEDLIAEPPTTHSFDKVWICSHALFEISKYVIYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVVIGPLCTSVGRIFSSVSMQLSHD