May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity).

Belongs to the caveolin family.

162 amino acids

MGLEKEKLECSIIMDEDEFNRSIEPILSKKARLYSSAPDRDPHDINAQLKVGFEDVIAEPASAHSFDRVWIGSSATFELVKFIFYRLLTTLLAVPAAFILGVVFGVLSCIHIWLVMPVTRSFLMLLPSIQVVWKSVTDMFITPLFHSMGRSLSSIQVRTSDT

18.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cav2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here