BVES

Blood vessel epicardial substance

360 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells (PubMed:16188940). Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading (By similarity). Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density (PubMed:26642364). Is also a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury.

Belongs to the popeye family.

41.451 kDa

MNYTESSPLRESTAIGFTPELESIIPVPSNKTTCENWREIHHLVFHVANICFAVGLVIPTTLHLHMIFLRGMLTLGCTLYIVWATLYRCALDIMIWNSVFLGVNILHLSYLLYKKRPVKIEKELSGMYRRLFEPLRVPPDLFRRLTGQFCMIQTLKKGQTYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPASPNTLKVHQLP

BVES

Blood vessel epicardial substance

360 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Important for skeletal muscle and heart development. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading (By similarity). Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density. Is a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury (By similarity).

Belongs to the popeye family.

41.444 kDa

MNYTESSPLAESTAIGFTPELGSITPVPSNETTCENWREIHHLVFHVANVFFAIGLVLPTTLHLHMILLRGMLTIGCTLYIVWATLYRCALDIMIWNSVFLGINVLHLSYLLYKKRPVKIEKELKGIYQRLFEPLRVPPDLFKRLTGQFCMIQTLKKGQAYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIIADDNCRFLCWSRERLTYFLESEPFLYEVFRYLIGKDITNKLYSLNDPTLNDKTIKKLDHQLSLCTQLSMLEMRNSIVSTSDSEDGLHQFLRGTSSVSSLYVPSPHQRASAKMKPIEEGVEDDDEVFEPETPNTFKVRQLP

Bves

Blood vessel epicardial substance

358 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells (PubMed:16188940). Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3 (PubMed:20057356). Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT (PubMed:18541910). Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading (PubMed:11839816). Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density (PubMed:26642364). Is a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury (PubMed:24066022).

Belongs to the popeye family.

41.016 kDa

MNSTESIPLAQSTVAGFTSELESLTPVPSNETTCENWREIHHLVFHVANVCFAVGLLIPTTLHLHMILLRVMLSLGCTLYVVWATLYRCALDVMIWNSVFLGINILHLSYLLYKKRPVKIEKELGGVYHRLFEPLRVPPDLFRRLTGQFCMIQTLKRGQVYATEDKTSVDDRLSILLKGRMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLCTQISMLEMRNSITSSSDGEDGLHHFLRGSSSTASLPMSSPQQRASAKMKPIEEGVEDDDEVFVSPDALKVHQLP

BVES

Blood vessel epicardial substance

357 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Involved in epithelial movement during corneal sheet formation and regeneration. May play a role in VAMP3-mediated vesicular transport and recycling of receptor molecules. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May be involved in skeletal muscle and heart development as well as in the maintenance of heart function (By similarity). May also be involved in striated muscle regeneration and in the regulation of cell spreading.

Belongs to the popeye family.

40.877 kDa

MDTTAISPLTPLGVIPDLKNATSVPFNETACENWKEIHHLVFHVANICFAAGLVIPTTLNLHMIFLRGLLTVGCALFIIWATLYRCALDIMIWNSVFLVVNLLHFIYLVYKRRPIKIEKELSSLYKRMFEPLHVPPELFQRLTGQFCNIQTLKTGQAYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMNRGEKFQVTIIADDNCKFLCWSRERLTYFLETEPFLYEIFKYLIGKDITNKLYSLNDPTLNDKASKKIDRQPSLCSQLSVMQMRNSMASTSDSEDGLQMFLRGTSSSSSLRPGRTSPYLRTSAKMKPIEESVEDDVFEAPSAEKLELQRLP

Bves

Blood vessel epicardial substance

356 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Plays a role in VAMP3-mediated vesicular transport and recycling of different receptor molecules through its interaction with VAMP3. Plays a role in the regulation of cell shape and movement by modulating the Rho-family GTPase activity through its interaction with ARHGEF25/GEFT. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Important for skeletal muscle and heart development. Also involved in striated muscle regeneration and repair and in the regulation of cell spreading (By similarity). Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density. Is a caveolae-associated protein important for the preservation of caveolae structural and functional integrity as well as for heart protection against ischemia injury (By similarity).

Belongs to the popeye family.

40.86 kDa

MNFTEPSPLAQSTVVGFLPELESLTPVPSNETSCENWREVHHLVFHAANVCFAVGLLIPTTLHLHMILLRVMLSIGCTLYVVWATLYRCALDMMIWNSVFLGINILHLSYLLYKKRPVKIEKDLGGVYHRLFEPLRVPPDLFRRLTGQFCVIQTLKRGQVYATEDKTSVDDRLSILLKGRMKVSYRGHFLHNIYPCAFIDSPEFRSTQMHKGEKFQVTIVADDNCRFLCWSRERLTYFLESEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKVKKLEPQMSLSTQISMLEMRNSITSSSDIEDGLHHFLRGSSSTASLPMSSPQQRASPKMKPIEEGLEDDDEVFVPVSPAHQLP

bves

Blood vessel epicardial substance

352 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in skeletal muscle and heart development as well as in the maintenance of heart function (PubMed:26642364). May play a role in vamp3-mediated vesicular transport and recycling of receptor molecules. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. May induce primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. May be involved in epithelial movement during corneal sheet formation and regeneration. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May also be involved in striated muscle regeneration and in the regulation of cell spreading (By similarity).

Belongs to the popeye family.

40.34 kDa

MSNTTSALPSSVPAVSLDPNATLCQDWEQSHHLLFHLANLSLGLGFLIPTTLALHMIFLRLLLMTGCSLFIAWATLYRCTLDVMVWNVVFLLVNFMHFFFLLYKRRPIKIDRELKSVYKRMFEPLHVREALFQRLTGQFCTIQTLKKGQVYAAEDKTSVDERLSILLKGKMKVSYRGHFLHNIYTNAFIDSPEFRSTQMNRGERFQVTIAAEENCKLLCWSRERLTYFLESESFLNEVFRYLIGKDITNKLYSLNDPTLSDKAVKKMDRQPSLCSQLSMMQMRNSMASTSDTDDVLNQILRGGSTGSSLQKNPLTKTSTTMKPIEEGLEDDVFESESPTTSQNVSKTTKKDI

bves

Blood vessel epicardial substance

338 amino acids

Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. May play a role in vamp3-mediated vesicular transport and recycling of different receptor molecules. May be involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. May induce primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. May be involved in epithelial movement during corneal sheet formation and regeneration. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May be involved in skeletal muscle and heart development as well as in the maintenance of heart function. May also be involved in striated muscle regeneration and in the regulation of cell spreading (By similarity).

Belongs to the popeye family.

38.805 kDa

MATESILITTLPMDLNSQINNVTFGLNENETLCENWREIHHLVFHLANTCFAAGLVIPSTLNLHMILLRGMLCLGCIFFIIWAILFRCALDIMIWNATFLSMNFMHFIYLVYKKRPIKIEKDLKGIYHRMFEPLHVSPELFNRLTGQFCEIKTLAKGQTYAIEDKTSVDDRLSILLKGIMKVSYRGHFLHAISPNAYIDSPEFRSTEMNRGETFQVTITADDNCVFLCWSRERLTYFLESEPFLYEIFKYLIGKDITTKLYSLNDPTLGKKKKLDTQPSLCSQLSVMEMRNSLASTSDNEDGLQTFLRGTSTTSSQRNNQQEFCNAYGVGPLSHAVFC