Cell adhesion molecule involved in the establishment and/or maintenance of cell integrity. Involved in the formation and regulation of the tight junction (TJ) paracellular permeability barrier in epithelial cells. Induces primordial adhesive contact and aggregation of epithelial cells in a Ca(2+)-independent manner. Involved in epithelial movement during corneal sheet formation and regeneration. May play a role in VAMP3-mediated vesicular transport and recycling of receptor molecules. May play a role in the regulation of cell shape and movement by modulating the Rho-GTPase activity. May be involved in skeletal muscle and heart development as well as in the maintenance of heart function (By similarity). May also be involved in striated muscle regeneration and in the regulation of cell spreading.

Belongs to the popeye family.

357 amino acids

MDTTAISPLTPLGVIPDLKNATSVPFNETACENWKEIHHLVFHVANICFAAGLVIPTTLNLHMIFLRGLLTVGCALFIIWATLYRCALDIMIWNSVFLVVNLLHFIYLVYKRRPIKIEKELSSLYKRMFEPLHVPPELFQRLTGQFCNIQTLKTGQAYAAEDKTSVDDRLSILLKGKMKVSYRGHFLHNIYPCAFIDSPEFRSTQMNRGEKFQVTIIADDNCKFLCWSRERLTYFLETEPFLYEIFKYLIGKDITNKLYSLNDPTLNDKASKKIDRQPSLCSQLSVMQMRNSMASTSDSEDGLQMFLRGTSSSSSLRPGRTSPYLRTSAKMKPIEESVEDDVFEAPSAEKLELQRLP

40.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make BVES using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here