AIM5

MICOS complex subunit MIC12

114 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

13.56 kDa

MSKIAKLGSFTLVSGVVATSCYYYFIDRDGYHYKRSVWKQVGDEVQRVIDRKPSLVFSKEKYGDQFDYDYKVSGERVERVPVDHKQLVLRYNSETMKDLWNKEVRALVDWVYSR

AIM5

MICOS complex subunit MIC12

106 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

12.388 kDa

MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

AIM5

MICOS complex subunit MIC12

106 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

12.388 kDa

MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

AIM5

MICOS complex subunit MIC12

106 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

12.388 kDa

MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

AIM5

MICOS complex subunit MIC12

106 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

12.388 kDa

MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVPGETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN

AIM5

MICOS complex subunit MIC12

102 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

11.579 kDa

MSKVLKLTSVTLAASSLAAAGYFYAFDRDSYHYKNASWKRIGDHVQGILDRKEDIAVQRTSSEARDVTVRPIKETMKDLWNEQVRNTAQWVYSFGSNTSTKA

AIM5

MICOS complex subunit MIC12

100 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

11.626 kDa

MSKIWKFTSFATISSVAAASLYLYAIDKNGYYYEKSKFKQVTDRVRKLIDGDETFKYVTIDDFVSGPTQIQTRSRGETFKDLWNAEVRRTAQWIYSLGGR

AIM5

MICOS complex subunit MIC12

97 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

11.188 kDa

MSKLIKLTSITAVSSTLAASYYFYFVDRDGFHYQNSQWKKIGDKVQGIIDGSENINPSTPSNSNQVIVVKRPMTETMKDLWNEQIRNTANWFYSWGK

AIM5

MICOS complex subunit MIC12

94 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

11.106 kDa

MPRLLRYGSFSVVASVLGASYYYYAVASPLYTEAEWHRVSQRTAALIDRRIDIPVPESTTERREYVVRSSKETMKDIWNEQIRSIVDWIYSWSH

AIM5

MICOS complex subunit MIC12

94 amino acids

Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

11.095 kDa

MSKLLKLTGFTTLSTLLGVSYYYYVIDRPLYQQTALHKTNVQVENIIDNKAQFQYEHMSRDSQAVVQRPFAETVKDIWNKEVRNTADWLYSWGK