Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.

Belongs to the MICOS complex subunit Mic12 family.

94 amino acids

MSKLLKLTGFTTLSTLLGVSYYYYVIDRPLYQQTALHKTNVQVENIIDNKAQFQYEHMSRDSQAVVQRPFAETVKDIWNKEVRNTADWLYSWGK

11.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AIM5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here