aif1

Apoptosis-inducing factor 1

611 amino acids

Putative FAD-dependent oxidoreductase involved in the resistance to cercosporin and other singlet oxygen-generating photosensitizers. Translocates from mitochondria to the nucleus under apoptotic conditions, where it degrades DNA and induces apoptosis (By similarity).

Belongs to the FAD-dependent oxidoreductase family.

66.566 kDa

MLLRFFINQPRFIQFTFLRNKKDRILGLQLGKQPFRMSSSSGLKQQGLAQKKKFQLEFDPSSVSKNGTKTEAKVVGTEFGVLLVRARNTYFATAGKCSHYGAPLAKGVVTSDGHIVCPWHGACFNAATGDVEDTPAIAALRTFPVTEEGDGSLWIEVEDKNDNGASVLQPEGCWRNKATEVYNKGSVETEVTAPHVCIIGGGKGASVAAEYLREKNFKGKITIFTREDEVPYDRPKLSKSLLHDISKLALRSKEYYDDLDISFHFNTDVTKIDLAEKKIYCGSDEKPTESYTKLILATGGEPNKLPIPGLDSKNVYLLRSIADASKLAAVTTEAGDKKNIVIIGSSFIGLELAVVLKDHNVSVIGMESIPFEKVMGKEVGTALKALHEQNGIAFYLENSIKEVKTSSNDSSKAEHIVLKDGQSIPADVVILAAGVKPNLRYLGNAVSLEKDGGVKVDEHCRVLGAEDVYAVGDIAHAPFAGLPSSGEKSHTRIEHWDVAGNLGRVAADHILFGNKAGYTTKSFTPYFWSAQGKQLRYCGNNAAEGFDDVVIQGSLSDYKFACFFTKGEKVVGVCSIMKDPVVSQCARLFIKDAMPSKSQLKENFDVLSIPL

AIF1

Apoptosis-inducing factor 1

378 amino acids

Putative FAD-dependent oxidoreductase involved in the resistance to cercosporin and other singlet oxygen-generating photosensitizers. Translocates from mitochondria to the nucleus under apoptotic conditions, where it degrades DNA and induces apoptosis.

Belongs to the FAD-dependent oxidoreductase family.

41.335 kDa

MTINTKNIVVVGAGVFGVSVANHLYRELGGTYAIKLVTASNYVYFLPSAVRLTVSKDYTKSILPLKNVLDSGIEVIKDTAASFDDKEVVLGSDRAIKFDILVLATGSKWADPIGSTYTFGDNYKEYFEREASRISDADHILFLGGGFVNCELAGELLFKYLEEIRSGKKRISIIHNSDKLLPDSGLYNDTLRKNVTDYLSKNGITLYLNTVGASLDTSPKRIFLGEGSSKYIDADLIYRGVGISPNVPVNSISDLCDKKGFIQVEKNFRVKAVEAGNVFAIGDVTNFRYHGLVKRDNWVDVLTRNVISSLQEGTEASLVDADCLETGHAPSGVSLGPNAGFGQFPLPLLGTINIPSFLISRAKSKNLFSDKMEPLFKK

AIF1

Allograft inflammatory factor 1

147 amino acids

May play a role in macrophage activation and function.

16.855 kDa

MSETRDLQGGKAFGLRKAQQEERINEINQQFLDDPKYSSDEDLPSKLEAFKKKYMEFDLNEDGGIDIMSLKRMMEKLGVPKTHLELKKLIMEVSSGPGETFSYSDFLKMMLGKRSAILKMILMYEEKAREQEKPTGLPAKKAISELP

AIF1

Allograft inflammatory factor 1

147 amino acids

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

16.703 kDa

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

AIF1

Allograft inflammatory factor 1

147 amino acids

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).

16.719 kDa

MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLLSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP

Aif1

Allograft inflammatory factor 1

147 amino acids

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.

16.911 kDa

MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP

Aif1

Allograft inflammatory factor 1

147 amino acids

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play an role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity).

16.827 kDa

MSQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP

AIF1

Allograft inflammatory factor 1

146 amino acids

Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity). Has a dual influence on glucose-induced insulin secretion: inhibition at low concentration and stimulation at high concentrations.

16.56 kDa

SETIDLQGGKAFGLLKAQQEGRLNEINKQFLDDPKYSSDEDLSRKLEAFKQKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIKEVSSGSGETFSYSIFLKMMLGKRSAILKMILMYEEKAREQEKPTGPPAKKAISELP