Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation (By similarity). Has a dual influence on glucose-induced insulin secretion: inhibition at low concentration and stimulation at high concentrations.

146 amino acids

SETIDLQGGKAFGLLKAQQEGRLNEINKQFLDDPKYSSDEDLSRKLEAFKQKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIKEVSSGSGETFSYSIFLKMMLGKRSAILKMILMYEEKAREQEKPTGPPAKKAISELP

16.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AIF1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here