agl14

Probable low-salt glycan biosynthesis reductase Agl14

300 amino acids

Reductase involved in N-glycan biosynthetic pathway that takes place under low-salt conditions (1.75 M instead of 3.4 M). Participates in the formation of the tetrasaccharide present at 'Asn-532' of S-layer glycoprotein Csg, consisting of a sulfated hexose, 2 hexoses and rhamnose. Involved in the addition of final rhamnose (sugar 4) of the tetrasaccharide on the dolichol phosphate carrier.

Belongs to the dTDP-4-dehydrorhamnose reductase family.

31.977 kDa

MYAFVTGANGLLGSVVVRTLREQGHAVVGSYHSEEPTFDCPLHQVDITDTERVVELLDEYDVDLVINCAAYTDVDGCESNPEVATAVNGTAPGDLAAVCDDREIPFIHYSTDYVFDGETDGFYEEGDEPAPIQEYGRSKLTGEHAVRDVNPDALILRLSFVYGARGDTSDLVGFPQWVASTLAAGDTVPLFTDQTMTPSRAGNVATTTLELLDAGVSGTFHVASQSAVTPSDFGEKICEVIGGDATLIESSVMADLDRPAARPRRSCLDVSNVEGELGCSQPTLEDDLAALEAAFSDYSS

AGL14

Agamous-like MADS-box protein AGL14

221 amino acids

Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918).

25.492 kDa

MVRGKTEMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSSSSIPKTVERYQKRIQDLGSNHKRNDNSQQSKDETYGLARKIEHLEISTRKMMGEGLDASSIEELQQLENQLDRSLMKIRAKKYQLLREETEKLKEKERNLIAENKMLMEKCEMQGRGIIGRISSSSSTSELDIDDNEMEVVTDLFIGPPETRHFKKFPPSN