Reductase involved in N-glycan biosynthetic pathway that takes place under low-salt conditions (1.75 M instead of 3.4 M). Participates in the formation of the tetrasaccharide present at 'Asn-532' of S-layer glycoprotein Csg, consisting of a sulfated hexose, 2 hexoses and rhamnose. Involved in the addition of final rhamnose (sugar 4) of the tetrasaccharide on the dolichol phosphate carrier.

Belongs to the dTDP-4-dehydrorhamnose reductase family.

300 amino acids

MYAFVTGANGLLGSVVVRTLREQGHAVVGSYHSEEPTFDCPLHQVDITDTERVVELLDEYDVDLVINCAAYTDVDGCESNPEVATAVNGTAPGDLAAVCDDREIPFIHYSTDYVFDGETDGFYEEGDEPAPIQEYGRSKLTGEHAVRDVNPDALILRLSFVYGARGDTSDLVGFPQWVASTLAAGDTVPLFTDQTMTPSRAGNVATTTLELLDAGVSGTFHVASQSAVTPSDFGEKICEVIGGDATLIESSVMADLDRPAARPRRSCLDVSNVEGELGCSQPTLEDDLAALEAAFSDYSS

32 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make agl14 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here