AC2

Transcriptional activator protein

172 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

19.551 kDa

MESRFKLKEEYHQSCCAIQVRVPVIKTSSTKRKTELYTTGPFIMRSSSPSQPPSIKAQHRIAKHKAIRRRRIDLNCGCSIFYHIKCADHGFTHRGEHHCASGREFRFYLGGTKSPLFQDHAGGRSSIHTDKDIPHPSQVQSQPQESTGSPQSIPELPSLDDIDSSFWDDIFK

AC2

Transcriptional activator protein

172 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

19.59 kDa

MESRFKLKEEYHQSCCAIQVRVPVIKTSSTKRKNQLYTTGPFIMRSSSPSQPPSIKAQHRIAKHKAIRRRRIDLNCGCSIFYHIKCADHGFTHRGEHHCASGREFRFYLGGTKSPLFQDHAGGRSSIHTDKDIPHPNQVQSQPQESTGSPQSIPELPSLDDIDSSFWDDIFK

AC2

Transcriptional activator protein

138 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

15.343 kDa

MTGSKKTPSTSPSKKLSSPPEVKLRHRFAKRQIRRRRIDLACGCSIYIHINCVNNGFTHRGTHHCSSSSEWRFYLGASKSPIFQNTASGDANVHTQPGISHSSQSKPQHEDSVGSPQSLLQLPSLDDVDDDFWADLLK

AC2

Transcriptional activator protein

135 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

15.159 kDa

MQSSSPSQNHSTQVPIKVTHRQVKKRAIRRRRVDLVCGCSYYLHINCFNHGFTHRGSHHCSSSNEWRVYLGNKQSPVFHNHQAPTTTIPAEPGHHNSPGSIQSQPEEGAGDSQMFSQLPDLDNLTASDWSFLKGL

AC2

Transcriptional activator protein

135 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

15.178 kDa

MQSSSPSPNHSTQVPIKVSHRQFKKRAIRRRRVDLVCGCSYYLHINCSNHGFTHRGTHHCSSSNEWRVYLGNKQSPVFHNHQAPTTTIPAEPGHHNSPGSIQSQPEEGAGDSQMFSQLQDLDDLTASDWSFLKSL

AC2

Transcriptional activator protein

135 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

15.349 kDa

MRPSSPSKDHYTQVPIKVQHRAAKRKRIRRKRVDLNCGCSYYVHINCHNHGFTHRGTHHCSSGDEWRLYLGGTKSPLFQDHSTRQQTVRNEPGHNNRPDTVQPQPEESVGTTSMLDGFQGLDDLTASDLAFLEGI

AC2

Transcriptional activator protein

135 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

15.219 kDa

MRNSTPSKNHFSPPSIKAQHKVAKKRAIRRSRIDLSCGCSYYIHINCRNYGFSHRGQHHCSSTQEWRLYLGGAKSPLFQDHAAPSNSSRVPDVCDPNTDNVQPRVEESTADAQMLPGSDALPLFDGDFWDDIIDF

AC2

Transcriptional activator protein

131 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

14.584 kDa

MPNSSSSKVPSIKAQHRIAKKRAVRRRRIDLDCGCSIYIHINCAKDGNGFTHMGRHHCASGREFRFYLGGSKSPLFQDVQXGGSTLHAHKDIPHTNPVQPQPEESTKSSQSVPELPSLDGIDSSFWDDIFE

AC2

Transcriptional activator protein

129 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

14.627 kDa

MRSSSPSQPPSIKKAHRQAKRRAIRRRRIDLQCGCSIYFHIDCTGHGFTHRGIHHCTSGGEWRVYLGDSKSPVFQDIQSRGPAIHQNEDIPCTNTVQPQPEESVASPQSLPELPSLDDFDDSFWVNLFK

AC2

Transcriptional activator protein

129 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

14.634 kDa

MQNSSLLKPPSIKAQHKIAKRRAVRRRRIDLNCGCSIFLHINCADNGFTHRGEHHCSSGREFRFYLGGSKSPIFQDTTRRGPVVHQNQDLPHPSPVQPQPTESIGSPQSLLQLPSLDDFDESFWADIFK

AC2

Transcriptional activator protein

129 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase (ADK), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity.

Belongs to the geminiviridae transcriptional activator protein family.

14.888 kDa

MRNSSSSTPPSIKAQHRAAKRRAIRRRRIDLNCGCSIYIHIDCRNNGFTHRGTYHCASSREWRLYLGDNKSPLFQDNQRRGSPLHQHQDIPLTNQVQPQPEESIGSPQGISQLPSMDDIDDSFWENLFK

AC2

Transcriptional activator protein

129 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

14.503 kDa

MRSSSPSQPPSIKRAHRQAKKRAIRRRRVDLQCGCSIYFHLGCAGHGFTHRGTHHCTSGGEWRVYLGARKSPLFQDTQSRGPTVYQNEGIPRTDTVQPQPEESVASPQSLPELPSLDDVDDSFWINLFS

AC2

Transcriptional activator protein

129 amino acids

Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).

Belongs to the geminiviridae transcriptional activator protein family.

14.736 kDa

MRSSSPSQPPSIKKAHRQAKKRAIRRRRIDLDCGCSIYFHIDCAGHGFTHRGAHHCTSGREWRVYLGDRKSPLFQDKPSRGHAIHQDQDIQRPNPVQPQPQESIGSPQSIPELPSLDDIDDSFWVELFS