About Products Protein Database Contact

Protein expression services for AC2 | Transcriptional activator protein

Description
Strong activator of the late viral genes promoters. Enhances the expression of the capsid protein and nuclear shuttle protein. Acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. Suppresses the host RNA silencing by inhibiting adenosine kinase 2 (ADK2), a kinase involved in a general methylation pathway. Also suppresses the host basal defense by interacting with and inhibiting SNF1 kinase, a key regulator of cell metabolism implicated in innate antiviral defense. Determines pathogenicity (By similarity).
Family
Belongs to the geminiviridae transcriptional activator protein family.
Species
Pepper huasteco yellow vein virus
Length
138 amino acids
Sequence
MTGSKKTPSTSPSKKLSSPPEVKLRHRFAKRQIRRRRIDLACGCSIYIHINCVNNGFTHRGTHHCSSSSEWRFYLGASKSPIFQNTASGDANVHTQPGISHSSQSKPQHEDSVGSPQSLLQLPSLDDVDDDFWADLLK
Mass
15.3 kDa
Simulated SDS-PAGE
Western blot of AC2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AC2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here