AAEL011283

Cytoplasmic tRNA 2-thiolation protein 1

341 amino acids

Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.

Belongs to the TtcA family. CTU1/NCS6/ATPBD3 subfamily.

38.375 kDa

MPILCTTGCSRKAFLKRPKTGDTLCRECFFLAFETEIHNTIEQNKLFRRGDVVAIAASGGKDSTVLAHVLKVLNERYDYGLKLVLLSIDEGITGYRDDSLETVKRNRDDYGMELKILSYDELYGWTMDKIVSKIGRSNNCTFCGVFRRQALDRGARLMEVDCVATGHNADDIAETVLMNILRGDTARLRRCCDIKTGGKDADSIPRVKPLKYAYEKEIVMYAHFKKLVYFSTECVFAPNAYRGHARAFLKDLERIRPSVIMDIIHSGEQLSFKDTVKKPLRGKCNRCGFVSSQQPCKACVLLEGLNRGLPKLGVGKKSKANRMIAAQNSLRQSANLVKTDF