Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position.

Belongs to the TtcA family. CTU1/NCS6/ATPBD3 subfamily.

341 amino acids

MPILCTTGCSRKAFLKRPKTGDTLCRECFFLAFETEIHNTIEQNKLFRRGDVVAIAASGGKDSTVLAHVLKVLNERYDYGLKLVLLSIDEGITGYRDDSLETVKRNRDDYGMELKILSYDELYGWTMDKIVSKIGRSNNCTFCGVFRRQALDRGARLMEVDCVATGHNADDIAETVLMNILRGDTARLRRCCDIKTGGKDADSIPRVKPLKYAYEKEIVMYAHFKKLVYFSTECVFAPNAYRGHARAFLKDLERIRPSVIMDIIHSGEQLSFKDTVKKPLRGKCNRCGFVSSQQPCKACVLLEGLNRGLPKLGVGKKSKANRMIAAQNSLRQSANLVKTDF

38.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AAEL011283 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here