rpl7ae

50S ribosomal protein L7Ae

151 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

16.143 kDa

MAVTIDPKTFYANPPPGKPFYVRFEVPNDVAEKALEILSIARQTGKIKKGTNETTKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKVPYVYVPSKEKLGKAAGINVSAAAAVVIEPGQAAGELEALVSKINEVRAKHGLNAIPVPAKR

rpl7ae

50S ribosomal protein L7Ae

151 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

15.991 kDa

MAVTIDPKTFYANPPPGKPFYVRFEVPADVAEKALEVLSVAKQTGKIKKGTNEATKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKVPYVYVPSKEKLGKAAGINVSAAAAVVIEPGQAAGELEALVSKVNEIRAKNGLNAIPLPGRK

rpl7ae

50S ribosomal protein L7Ae

149 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

15.991 kDa

MAVTIDPKTFYANPLPGKPFYVRFEVPSDVAEKALEILSIARQTGKIKKGTNETTKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKVPYVYVPSKEKLGKAAGINVAAAAAVVIEAGQAAGELEALVNKINEIRAKHGLNAIPVRR

rpl7ae

50S ribosomal protein L7Ae

128 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.836 kDa

MSKPFYVRFEVPPELAEKAYEALRKARESGGKIKKGTNETTKAVDKGLAKLVLIAEDVDPPEIVAHLPLLCEEKKIPYVYVPSKKKLGEAAGIEVQAAAAAIIDPGAAKDLVEEIIKEVEQIKAKAGL

rpl7ae

50S ribosomal protein L7Ae

128 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.444 kDa

MGKAYYVKFETPEDLVNPILEAVRVASTSGKVKKGTNEATKAIERGTSKLIVIAEDVEPPEVVAHLPILCEEQGAAFAFVPSKQELGKSLGIDITSAAAAILDAGDAQHIVDQVVSSIAKIKGGKTDQ

rpl7ae

50S ribosomal protein L7Ae

128 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.794 kDa

MSKPFYVKFEVPPELAEKVYEAVKKARETGGKIKKGTNETTKAVERGIAKLVIIAEDVDPPEIVAHLPLLCDEKKIPYVYVPSKKRLGEAAGIEVAAASAAIIDPGGAKDLVEEIIKQVQELRAKAGA

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.872 kDa

MSKPFYVRFEVPPELAEKAYQALEIARKTGKIKKGTNETTKCVERGLAKLVLIAEDVDPPEIVAHLPLLCEEKKIPYVYVPSKKRLGEAAGIEVAAASACIIDPGEAKNLVEEIVKAVNELKTKAAQ

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.952 kDa

MSKPIYVRFEVPEDLAEKAYEAVKRARETGRIKKGTNETTKAVERGLAKLVVIAEDVDPPEIVMHLPLLCDEKKIPYVYVPSKKRLGEAAGIEVAAASVAIIEPGDAETLVREIVEKVKELRAKAGV

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.697 kDa

MPKPFYVKFEVPPELADKVYQAISKVRETGGKIKKGTNETTKAVERGQAKLVVIAEDVDPPEIVAHLPLLCDEKKIPYVYVPSKQKLGQAAGIEVSAASVAVIDVGGAKDLIDEIIKSVQQIRAQSG

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

14.044 kDa

MESYVKFQTPETLEKAVLDMVENSYKTGKVRKGTNEVVKSIERGESKLVVIAEDVSPAEVVYYLPTLCEERKVPYVYVKKKSDLGLKVGIASAASVSIVDYGKNDDAYKSIVSQINDAKSGKSENKE

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.736 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

127 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.708 kDa

MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVVIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIVKRVNEIKGKTSS

rpl7ae

50S ribosomal protein L7Ae

126 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.273 kDa

MAKGYYVKFETPKDLVNPILEALRAATQSGKVKKGTNEATKAIERGTSKLVVIAEDVEPPEVVAHLPILCDEQGAAYAFVPSKQDLGKALGIDITSAAAILDSGDAQHIVDQVISSIAKIKGETGK

rpl7ae

50S ribosomal protein L7Ae

126 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.677 kDa

MSKPSYVKFEVPQELADKVLEAVKKAKDSGKIKKGTNETTKAVERSQAKLVVIAEDVQPEEIVAHLPLLCEEKKIPYVYVPSKKSLGEACGLQVAAASVALMDPGEAKDLVDEIVKRVNEIKGKSS

rpl7ae

50S ribosomal protein L7Ae

126 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.57 kDa

MSKPSYVKFDVPEDLANKVLDAVRKAKESGKIKKGTNETTKAVERGQAKLVVIATDVQPEEIVAHLPLLCEEKKIPYVYVPSKKALGEACGLQVAAASAAIIDPGEAKDLLDEIVKRVEELKGKAS

rpl7ae

50S ribosomal protein L7Ae

125 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.39 kDa

MAKPSYVKFDVPPELAEKALEALKKAKETGKIRKGTNEATKAIERGQAKLVLIAEDVQPEEIVAHLPPLCEEKKIPYIYVPTKKGIGEACGLQVGAAAAAILDPGQGKDVLDEVIKRVSELTGKS

rpl7ae

50S ribosomal protein L7Ae

125 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.669 kDa

MAEKPPYVKFEVPEELANKVYELVRKARETGKIRKGTNETTKAVERGQAKLVIIAENVNPPEIVMHLPALCEEKGVPYVYVPSKEELGKAAGINVSAASAAIIDAGEAKDLLEEIIRSVQELKAK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.222 kDa

MAKPTYVKMDFPQELQDKALEALELARDTGKIRKGTNEVTKAIERGVAQLVIVGEDVTPEEIVAHIPALSDEKKIPYVFVKKQQELGAASGLEVGCATSAIVDAGKAKALVDEITQKFSALKA

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.485 kDa

MSKPMYVKFEVPEELAEKAYEALEIARDTGRIRKGTNETTKAVEREEAVLVLIAEDVDPEEVVAHLPELCDEKGIPYVYVPSKDELGAAAGIDVAAASACIIDPGDAKDLVDEIIEKVEELRE

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.912 kDa

MAKAIYVKFDTPEELANQAEEALKTAQDSGKVAKGTNEVTKFIERGDAALVVIAEDVDPAEIVAHIPVLADEKEIPYIYLPTKEQVGGAAGLTVGTASACIVDAGDAEGDVAEIVEKIAELKE

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.292 kDa

MANSVYVKFEVPKEIADKVYEALEIARDTGKIGKGTNEVTKNIERNNVALAVIAEDIEPAEIVAHLPILAEEKEIPYVYLPTKEELGEAAGLNVGTASACIIDAGEGQELVDEIVEKVAELKN

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.154 kDa

MAKAIYVKFDVPKELADKAAEALEIARETGKVSKGTNEVTKAVERGVAQLVLIAEDVEPAEIVAHLPLLAEEKEIPYIYIPTKDELGAAAGLNVGTASSAIVEAGDAEDLIKEIIEKVEELKK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.423 kDa

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs. Component of the 70S ribosome (PubMed:23222135). Component of a box C/D small ribonucleoprotein (sRNP) particle that is involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in rRNA and tRNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.395 kDa

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELMK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, box H/ACA, box C/D and box C'/D' sRNAs (By similarity). When added to reconstituted ribonuclease P (RNase P) it increases the optimum temperature to that of the partially purified enzyme and causes a 5-fold increase in apparent Vmax. Binds the RNase P catalytic RNA.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.423 kDa

MAKPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVRELMK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.424 kDa

MAKPSYVKFEVPQELAEKALEAVEIARDTGRIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGLEVAAASVAIIEPGKARELVEDIAMKVKELMK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.436 kDa

MAKPSYVKFEVPQELAEKALEAVEIARDTGRIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYVYVPSKKELGAAAGLEVPAASVAIIEPGKARELVEDIAMKVKELMK

rpl7ae

50S ribosomal protein L7Ae

123 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.421 kDa

MAKPSYVKFEVPAELAEKALEAVELARDTGRIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVPAASVAIIEPGKGRELVEEIAMKVRELMK

rpl7ae

50S ribosomal protein L7Ae

122 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.128 kDa

MARPIYVRFDVPPELASKSLEALELARDTGRIKKGTNEATKAVERGVAKLVIIGEDVEPPEIVAHLPPLCEEKNTPYVYVKKQSDVGAAAGLSVKSAAAAIIEPGKGKELLEEIIQKLQALK

rpl7ae

50S ribosomal protein L7Ae

121 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.435 kDa

MEKSYVKFETPEDVSQKALDLVESSYRTGKVKKGTNEVIKSIERGESKLVVIAEDVNPPEVVYYLPSLCEDKKVPYVYVKKKADLGSKVGIASAASVSIVDYGKNEELYKSIVSALEQIKK

rpl7ae

50S ribosomal protein L7Ae

121 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.389 kDa

MEKSYVKFETPEDVSQKALDLVESAFRSGKIKKGTNEVIKSIERGESKLVVIAEDVNPPEVVYYLPSLCEDKKVPYVYVKKKADLGSKVGIASAASVSIVDYGKNEELYKSIVSAVEQLKK

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.674 kDa

MPVYVDYETPADLAERSLEALEVARDTGTVKKGTNETTKAVERGNADLVIVAEDVSPEEIVMHLPELAEEKGIPVVFVDTQDEVGHAAGLEVGSAAAAVIDAGDADDDVEDIGEKVAELR

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.782 kDa

MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.73 kDa

MPVYVDYDVPADLQERALESLEVARDTGSVKKGTNETTKAIERGNADIVFVAEDVSPEEIVMHLPELAAEKGIEVVFVETQDELGNAAGLEVGSAAAAVVAAGDAEDEIEDISTKVEDLQ

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.73 kDa

MPVYVDYDVPADLQERALESLEVARDTGSVKKGTNETTKAIERGNADIVFVAEDVSPEEIVMHLPELAAEKGIEVVFVETQDELGNAAGLEVGSAAAAVVAAGDAEDEIEDISTKVEDLQ

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.639 kDa

MPVYVEFDVPADLADDALEALEVARDTGTVKKGTNETTKAIERGTAELVLVAEDVSPEEIVMHLPELADEKGITLAFVETQDEIGQAAGLEVGSAAAAIIDAGEADSDVDDITAKIEELR

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.725 kDa

MAQLAKFDVPEELTNKALEALELARDTGKIKKGTNEATKAIERGNAKLVLIAEDIEPAEIVAHIGPLSEEKKAPYIFIKNQKELGAASGLGVSCATVAIVDAGKAAEMVQDIAQKLEALK

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.739 kDa

MAQLAKFDVPEELTNKALEALELARDTGKIKKGTNEATKAIERGNAKLVLIAEDIEPAEIIAHIAPLSEEKKAPYIFIKNQKELGAASGLGVSCATVAIVDAGKAGEMVQDIAQKLEALK

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.727 kDa

MAQLAKFDVPEELTNKALEALELARDTGKIKKGTNEATKAIERGNAKLVLIAEDIEPAEIVAHIGPLSEEKKAPYIYIKNQKDLGAASGLGVSCATVAIVDAGKAAEMIQDIAQKLDALK

rpl7ae

50S ribosomal protein L7Ae

120 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.701 kDa

MSVYVDFDVPADLEDDALEALEVARDTGSVKKGTNETTKAVERGNAELVFVAEDVSPEEVVMHLPEIATEKEIPYVFVGTQDDIGHAAGLQVGSAAAAIVDAGEANGEVEDIAEKVEELQ

rpl7ae

50S ribosomal protein L7Ae

119 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

13.193 kDa

MYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGLQK

rpl7ae

50S ribosomal protein L7Ae

117 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.636 kDa

MAVYVKFDVPQEMEEKTAEVLSKSEKVKKGANEVTKAVERGTAKLVVLAKDVQPEEIVAHIPIICEEKGIPYTYIATKEDLGKAIGLEVSTAAVAIIAEKDANALKDLVEKINGLKA

rpl7ae

50S ribosomal protein L7Ae

117 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.686 kDa

MAVYVKFKVPEEIQKELLDAVAKAQKIKKGANEVTKAVERGIAKLVIIAEDVKPEEVVAHLPYLCEEKGIPYAYVASKQDLGKAAGLEVAASSVAIINEGDAEELKVLIEKVNVLKQ

rpl7ae

50S ribosomal protein L7Ae

117 amino acids

Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs (By similarity). Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends, this subunit dramatically stimulates RNase P activity.

Belongs to the eukaryotic ribosomal protein eL8 family.

12.381 kDa

MAVYVKFEISQELEEKTAEVVANAEKIKKGANEVTKAVEKGIAKLVVIAQDVQPEEIVAHIPVICDEKGIAYSYSSTKEALGKAAGLEVPTSAIAVVAEGSADELKDLVEKLNGLKA