Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D and box C'/D' sRNAs (By similarity). Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends, this subunit dramatically stimulates RNase P activity.

Belongs to the eukaryotic ribosomal protein eL8 family.

117 amino acids

MAVYVKFEISQELEEKTAEVVANAEKIKKGANEVTKAVEKGIAKLVVIAQDVQPEEIVAHIPVICDEKGIAYSYSSTKEALGKAAGLEVPTSAIAVVAEGSADELKDLVEKLNGLKA

12.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rpl7ae using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here