About Services Proteins Contact

fliN

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Rhizobium meliloti (strain 1021)
Length
198 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
19.942 kDa
Sequence
MAPKKAAPIAEPAVFAADAELDQAIDDLRGVLKKDGAADFGADFAAAGPLEQPMDFGSDFGSTDGAGFGGDFAAGFGGGLTETGAAGGFDAGSGFVGGDFDAAPIVGETAPGSGMTANMDLIMDIPIDVQIVLGTSRMQVSGLMALTEGATIALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLLEIKGTKK

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Rhizobium meliloti (strain 1021)
Length
198 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
19.942 kDa
Sequence
MAPKKAAPIAEPAVFAADAELDQAIDDLRGVLKKDGAADFGADFAAAGPLEQPMDFGSDFGSTDGAGFGGDFAAGFGGGLTETGAAGGFDAGSGFVGGDFDAAPIVGETAPGSGMTANMDLIMDIPIDVQIVLGTSRMQVSGLMALTEGATIALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLLEIKGTKK

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
179 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
18.803 kDa
Sequence
MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDFGDFGDFGSTDEVSTDNDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDDTRFGVKLIEVLSTRKA

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
179 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
18.803 kDa
Sequence
MATKKTPVTDDAALPSFEDGVDLDQAIGDLRGVLKTDAEGSLSDFGDFGDFGSTDEVSTDNDLSAFGGGAADFAMDDFAAAPQVAGVKAPLGSGLSENMEMIMDIPIDVQIVLGTSRMLVSGLMSLEEGATIALDRKIGEPVEIMVNGRRIARGEITVLEDDDTRFGVKLIEVLSTRKA

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
157 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
16.62 kDa
Sequence
MADEEKVTTEEQALADEWAAALAEAGDASQDDIDALMAQGGATPVAEPSTPRAPMEEFGASPKAPTISGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIRLTDVISPSERIKKLR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
157 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
16.62 kDa
Sequence
MADEEKVTTEEQALADEWAAALAEAGDASQDDIDALMAQGGATPVAEPSTPRAPMEEFGASPKAPTISGLEGPNLDVILDIPVTISMEVGHTDISIRNLLQLNQGSVIELDRLAGEPLDVLVNGTLIAHGEVVVVNEKFGIRLTDVISPSERIKKLR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Escherichia coli (strain K12)
Length
137 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation.
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.855 kDa
Sequence
MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
137 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.789 kDa
Sequence
MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Escherichia coli (strain K12)
Length
137 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation.
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.855 kDa
Sequence
MSDMNNPADDNNGAMDDLWAEALSEQKSTSSKSAAETVFQQFGGGDVSGTLQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
137 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.789 kDa
Sequence
MSDMNNPSDENTGALDDLWADALNEQKATTTKSAADAVFQQLGGGDVSGAMQDIDLIMDIPVKLTVELGRTRMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVADKYGVRITDIITPSERMRRLSR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Length
134 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
15.13 kDa
Sequence
MDNILVNNKNKNLLDLNKEDIKKSCEIEDKIFHSKTVNDVDLNLNSKNDISSKMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTENKYGIRIINIIDNSVFKKL

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Length
134 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
15.13 kDa
Sequence
MDNILVNNKNKNLLDLNKEDIKKSCEIEDKIFHSKTVNDVDLNLNSKNDISSKMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTENKYGIRIINIIDNSVFKKL

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Length
133 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.898 kDa
Sequence
MSKIQKNSDNDKLIDSEKKIPTDQDVDKNLLPQENSKNSTLDNTIDIVDSKKTILNVPVNITVELGTSRIKIKDFLKFSKGSMLILNESIKEPLNIFMNGHLIASGEIVVLEEKYGIRITNIKNSLKTINISS

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Length
133 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
15.403 kDa
Sequence
MKKVEKKDNFKKFKNDNIYKKDDKNINQELINEEKKIKNFNSSNNESSNEKKILFDIEMNITVELGKSKVKIKDLLNFSKGSMLFLQRKKEDPLKVFANNKLIALGEIVFSNNKYGIRIISINNSLNGINTSV

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Length
133 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
14.898 kDa
Sequence
MSKIQKNSDNDKLIDSEKKIPTDQDVDKNLLPQENSKNSTLDNTIDIVDSKKTILNVPVNITVELGTSRIKIKDFLKFSKGSMLILNESIKEPLNIFMNGHLIASGEIVVLEEKYGIRITNIKNSLKTINISS

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Length
133 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
15.403 kDa
Sequence
MKKVEKKDNFKKFKNDNIYKKDDKNINQELINEEKKIKNFNSSNNESSNEKKILFDIEMNITVELGKSKVKIKDLLNFSKGSMLFLQRKKEDPLKVFANNKLIALGEIVFSNNKYGIRIISINNSLNGINTSV

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Length
113 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
12.305 kDa
Sequence
MSVDEKSDNGEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSMQLTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKIVAKGEVVVIDENFGVRITEIIKTKNE

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680)
Length
113 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
12.305 kDa
Sequence
MSVDEKSDNGEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVSMQLTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKIVAKGEVVVIDENFGVRITEIIKTKNE

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Aquifex aeolicus (strain VF5)
Length
112 amino acids
Function
FliM is one of 2 proteins (FliG, FliN) that might form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (Potential).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
12.672 kDa
Sequence
MEEQTKEIQEEKKETPQEEVREEKKEEKKVSVIELIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDGKIGVKIKEVVKEQR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Aquifex aeolicus (strain VF5)
Length
112 amino acids
Function
FliM is one of 2 proteins (FliG, FliN) that might form a switch complex that is proposed to be located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (Potential).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
12.672 kDa
Sequence
MEEQTKEIQEEKKETPQEEVREEKKEEKKVSVIELIQHFSDIPVEVEVVVGRANKTLGELLAMGIGSVIEIDREPKDLVDIKVNGKLIAKGELVIIDGKIGVKIKEVVKEQR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Caulobacter vibrioides (strain ATCC 19089 / CB15)
Length
110 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
11.668 kDa
Sequence
MAEDNLTLDEFGGAMLASEAPIELSDKTAADLAPVFDVPVNISAVLGRANMSVAQLLQLGQGSILELDRKVGEAIDIYVNNRLVARGEVVVVDERLGVTMTEIIKDGDQG

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Caulobacter vibrioides (strain ATCC 19089 / CB15)
Length
110 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
11.668 kDa
Sequence
MAEDNLTLDEFGGAMLASEAPIELSDKTAADLAPVFDVPVNISAVLGRANMSVAQLLQLGQGSILELDRKVGEAIDIYVNNRLVARGEVVVVDERLGVTMTEIIKDGDQG

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Pectobacterium carotovorum subsp. carotovorum
Length
106 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
11.623 kDa
Fragment
single
Sequence
RPTTEGIFKSLDGHDPLGALQDIDLILDIPVKLTVELGRTKMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVSDKYGVRITDIITPSERMRRLSR

Gene
fliN
Protein
Flagellar motor switch protein FliN
Organism
Pectobacterium carotovorum subsp. carotovorum
Length
106 amino acids
Function
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Similarity
Belongs to the FliN/MopA/SpaO family.
Mass
11.623 kDa
Fragment
single
Sequence
RPTTEGIFKSLDGHDPLGALQDIDLILDIPVKLTVELGRTKMTIKELLRLTQGSVVALDGLAGEPLDILINGYLIAQGEVVVVSDKYGVRITDIITPSERMRRLSR