About Products Protein Database Contact

Protein expression services for fliN | Flagellar motor switch protein FliN

Description
FliN is one of three proteins (FliG, FliN, FliM) that form the rotor-mounted switch complex (C ring), located at the base of the basal body. This complex interacts with the CheY and CheZ chemotaxis proteins, in addition to contacting components of the motor that determine the direction of flagellar rotation (By similarity).
Family
Belongs to the FliN/MopA/SpaO family.
Species
Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Length
134 amino acids
Sequence
MDNILVNNKNKNLLDLNKEDIKKSCEIEDKIFHSKTVNDVDLNLNSKNDISSKMKFIMDVPVHLTIEVGTVKITIKDLLELRSKSILVLDKHAGDPLNILVNGYVIATGELVVTENKYGIRIINIIDNSVFKKL
Mass
15.1 kDa
Simulated SDS-PAGE
Western blot of fliN recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fliN using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here