About Services Proteins Contact

bol

Gene
bol
Protein
Protein boule
Organism
Drosophila melanogaster
Length
228 amino acids
Function
RNA-binding protein that plays a central role in spermatogenesis. Required for meiotic entry and germline differentiation, at the transition between G2 and M phases of meiosis I. Acts by regulating translation of specific mRNAs, possibly by binding to their 3'-UTR. Essential for translation of twine (twe) mRNA. Required for the expression of various genes such as CG6784, CG17210, CG15841 scpr-B, scpr-C, and rho-6.
Similarity
Belongs to the RRM DAZ family.
Mass
24.682 kDa
Sequence
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV