About Products Protein Database Contact

Protein expression services for bol | Protein boule

Description
RNA-binding protein that plays a central role in spermatogenesis. Required for meiotic entry and germline differentiation, at the transition between G2 and M phases of meiosis I. Acts by regulating translation of specific mRNAs, possibly by binding to their 3'-UTR. Essential for translation of twine (twe) mRNA. Required for the expression of various genes such as CG6784, CG17210, CG15841 scpr-B, scpr-C, and rho-6.
Family
Belongs to the RRM DAZ family.
Species
Drosophila melanogaster
Length
228 amino acids
Sequence
MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV
Mass
24.7 kDa
Simulated SDS-PAGE
Western blot of bol recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make bol using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here