About Services Proteins Contact

SIM

Gene
sim
Protein
Protein single-minded
Organism
Drosophila melanogaster
Length
697 amino acids
Function
Transcription factor that functions as a master developmental regulator controlling midline development of the ventral nerve cord. Required to correctly specify the formation of the central brain complex, which controls walking behavior. Also required for correct patterning of the embryonic genital disk and anal pad anlage. Plays a role in synapse development.
Mass
76.475 kDa
Sequence
MTNHRRVRKDCYESRLHDIAKTCAMKEKSKNAARTRREKENTEFCELAKLLPLPAAITSQLDKASVIRLTTSYLKMRQVFPDGLGEAWGSSPAMQRGATIKELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELTGNSIFEYIHNYDQDEMNAILSLHPHINQHPLAQTHTPIGSPNGVQHPSAYDHDRGSHTIEIEKTFFLRMKCVLAKRNAGLTTSGFKVIHCSGYLKARIYPDRGDGQGSLIQNLGLVAVGHSLPSSAITEIKLHQNMFMFRAKLDMKLIFFDARVSQLTGYEPQDLIEKTLYQYIHAADIMAMRCSHQILLYKGQVTTKYYRFLTKGGGWVWVQSYATLVHNSRSSREVFIVSVNYVLSEREVKDLVLNEIQTGVVKREPISPAAQAAQAAQAAQAAQAAQAAQAAQAAQAAQAAHVAQAVQAQVVVVPQQSVVVQPQCAGATGQPVGPGTPVSLALSASPKLDPYFEPELPLQPAVTPVPPTNNSSSSSNNNNGVWHHHHVQQQQQSGSMDHDSLSYTQLYPPLNDLVVSSSSSVGGGTASSAGGGSSASASSSGVYSTEMQYPDTTTGNLYYNNNNHYYYDYDATVDVATSMIRPFSANSNSCSSSSESERQLSTGNASIVNETSPSQTTYSDLSHNFELSYFSDNSSQQHQHQQQQQHLMEQQHLQYQYATW

Gene
SIM
Protein
Cyclin-dependent protein kinase inhibitor SIM
Organism
Arabidopsis thaliana
Length
127 amino acids
Function
Cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967). Inhibits the kinase activity of CYCD3-1/CDKA-1, CYCD2-1/CDKA-1 and CYCB1-1/CDKB1-1 complexes in a dose dependent manner (PubMed:26546445). Cooperates with SMR1 and SMR2 to promote endoreplication during leaf development (PubMed:26546445). Required for normal trichome endoreplicating cell cycles (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967). Positive regulator of effector-triggered immunity (ETI) (PubMed:25455564).
Mass
14.091 kDa
Sequence
MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRSFRSCSRR