Protein expression services for SIM | Cyclin-dependent protein kinase inhibitor SIM
Description
Cyclin-dependent protein kinase (CDK) inhibitor that functions as a repressor of mitosis in the endoreduplication cell cycle (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967). Inhibits the kinase activity of CYCD3-1/CDKA-1, CYCD2-1/CDKA-1 and CYCB1-1/CDKB1-1 complexes in a dose dependent manner (PubMed:26546445). Cooperates with SMR1 and SMR2 to promote endoreplication during leaf development (PubMed:26546445). Required for normal trichome endoreplicating cell cycles (PubMed:10952891, PubMed:11882294, PubMed:17098811, PubMed:17764505, PubMed:19717615, PubMed:20194967). Positive regulator of effector-triggered immunity (ETI) (PubMed:25455564).
Species
Arabidopsis thaliana
Length
127 amino acids
Sequence
MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRPPSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRSFRSCSRR
Mass
14.1 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make SIM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here