About Services Proteins Contact

SFXN1

Gene
SFXN1
Protein
Sideroflexin-1
Organism
Bos taurus
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Similarity
Belongs to the sideroflexin family.
Mass
35.69 kDa
Sequence
MSGELPPNINIKEPRWDQSTFIGRAKHFFTVTDPRNILLTNEQLEAARKVVHDYRQGIIPSGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPVQVGIVGFCLVFATPLCCALFPQKSSMSVTSLEAELQARIRETYPELRRVYFNKGL

Gene
SFXN1
Protein
Sideroflexin-1
Organism
Homo sapiens
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (PubMed:30442778). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (PubMed:30442778). Transports both D-serine and L-serine (PubMed:30442778). Also able to transport other amino-acids, such as alanine (PubMed:30442778). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Similarity
Belongs to the sideroflexin family.
Mass
35.619 kDa
Sequence
MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKIVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL

Gene
Sfxn1
Protein
Sideroflexin-1
Organism
Mus musculus
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway (By similarity). Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors (By similarity). Transports both D-serine and L-serine (By similarity). Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (PubMed:11274051).
Similarity
Belongs to the sideroflexin family.
Mass
35.649 kDa
Sequence
MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDELQASIQRTHPEIRRVYFNKGL

Gene
SFXN1
Protein
Sideroflexin-1
Organism
Sus scrofa
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Similarity
Belongs to the sideroflexin family.
Mass
35.624 kDa
Sequence
MSGELPPNINIKEPRWDQSTFVGRANHFFTVTDPRNILLTNEQLENARKVVHDYRQGIVPPGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELRAGIPVTDENGNRLGESANAAKQAITQVVISRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIRETSPELRRVYFNKGL

Gene
Sfxn1
Protein
Sideroflexin-1
Organism
Rattus norvegicus
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Similarity
Belongs to the sideroflexin family.
Mass
35.546 kDa
Sequence
MSGEVPPNINIKEPRWDQSTFIGRASHFFTVTDPKNILLTNEQLENARKVVHDYRQGIVPAGLTENELWRAKYAYDSAFHPDTGEKMTLIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGTRLGESTNAAKQAITQVVISRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVTLVGFCLVFATPLCCALFPQKSSMSVTSLEDDLQASIQKSHPELRRVYFNKGL

Gene
SFXN1
Protein
Sideroflexin-1
Organism
Ovis aries
Length
322 amino acids
Function
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Similarity
Belongs to the sideroflexin family.
Mass
35.581 kDa
Sequence
MSGELPPNINIKEPRWDQSTFIGRAKHFFTVTDPRNILLTNAQLEAARKVVHDYRQGIVPSGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWVNQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLVGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESASAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPVQVGIVGFCLVFATPLCCALFPQKSSMSVTSLEAELQARIRETYPELRRVYFNKGL