Description
Mitochondrial serine transporter that mediates transport of serine into mitochondria, an important step of the one-carbon metabolism pathway. Mitochondrial serine is converted to glycine and formate, which then exits to the cytosol where it is used to generate the charged folates that serve as one-carbon donors. Transports both D-serine and L-serine. Also able to transport other amino-acids, such as alanine (By similarity). May be indirectly involved in the transport of a component required for iron utilization into or out of the mitochondria (By similarity).
Family
Belongs to the sideroflexin family.
Sequence
MSGELPPNINIKEPRWDQSTFIGRAKHFFTVTDPRNILLTNAQLEAARKVVHDYRQGIVPSGLTENELWRAKYIYDSAFHPDTGEKMILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWVNQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKRVSPLVGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESASAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPVQVGIVGFCLVFATPLCCALFPQKSSMSVTSLEAELQARIRETYPELRRVYFNKGL
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service