About Services Proteins Contact

PARA1

Gene
PARA1
Protein
Elicitin
Organism
Phytophthora parasitica
Length
118 amino acids
Function
Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.
Similarity
Belongs to the elicitin family.
Mass
12.336 kDa
Sequence
MNFRALFAATVAALVGSTSATTCTTTQQTAAYVALVSILSDTSFNQCSTDSGYSMLTATSLPTTEQYKLMCASTACKTMINKIVTLNPPDCELTVPTSGLVLNVFTYANGFSSTCASL