Induces local and distal defense responses (incompatible hypersensitive reaction) in plants from the solanaceae and cruciferae families. Elicits leaf necrosis and causes the accumulation of pathogenesis-related proteins. Might interact with the lipidic molecules of the plasma membrane.

Belongs to the elicitin family.

118 amino acids

MNFRALFAATVAALVGSTSATTCTTTQQTAAYVALVSILSDTSFNQCSTDSGYSMLTATSLPTTEQYKLMCASTACKTMINKIVTLNPPDCELTVPTSGLVLNVFTYANGFSSTCASL

12.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make PARA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here