About Services Proteins Contact

ND3

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Wickerhamomyces canadensis
Length
148 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
17.312 kDa
Sequence
MLNYFVYPYGIENDIGIKFYMILVPIISIVLIIINYIITNKSDNNINKTGPYECGFDSFRQSRTTYSIKFILIAILFLPFDLELTSILPYTLSIYNLNIYGLFILLYFLLPLIIGFIIEINLKAIYITKIFNRNVKSITSYVKYNNKI

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Ustilago maydis (strain 521 / FGSC 9021)
Length
143 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
16.621 kDa
Sequence
MNTITLFFLFIPILAVILLFANLLLAVHRPDSEKVTPYECGFSPVYGQTRNPFSIQFYLVGILFLVFDIEILLTYPYAMNLYQTSTYGFWIFVIFFLVLTVGFVYEFGTGALYFTDKRSSIQNTKISDSKHSPFFWSKSEKRL

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383)
Length
137 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
15.798 kDa
Sequence
MSSMTLFILFVSIIALLFLFINLIFAPHNPYQEKYSIFECGFHSFLGQNRTQFGVKFFIFALVYLLLDLEILLTFPFAVSEYVNNIYGLIILLGFITIITIGFVYELGKSALKIDSRQVITMTRFNYSSTIEYLGKI

Gene
nd3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Emericella nidulans
Length
136 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
15.65 kDa
Sequence
MTTTTFFLFLIPVLAIILLAVNLIFSPHNPYQEKDSAFECGFHSFLGQNRTQFSISFFIFALLFLLFDLEILLVYPYVVSAYTNGIYGLVIMLVFFLVGTLGFAFELGKNALKIESRQVYNFNYKSWSGYSLIYNK

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Candida parapsilosis
Length
131 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.682 kDa
Sequence
MFTAYLILCPIIAVVLVGLNWLLATSNSYIEKDGPFECGFTSFQQSRSAFSVAFILVAILFLPFDLEISSILPFVISPYSNGLYGLVILVIFLILLIVAFVVEIQLKALQLNRTYTNDLPHTELYDININD

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
Length
128 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.475 kDa
Sequence
MFTIYTYLAPIVAMVLVVLNYLISNNNSYIEKDGPFECGFTSYQQTRSAFSVAFILVAILFLPFDLEMSSILPYVVSAYSNGTYGLSILVIFLLSLVIAFVYEINLGALNLERRYTPIVKPLMNKLYL

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Yarrowia lipolytica (strain CLIB 122 / E 150)
Length
128 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.47 kDa
Sequence
MNTFIIFIILIPIVGFALLAVNILLAVYKPYNEKLGAFECGLTSFNQTRLAFNAAFILVAILFLPFDLEISTLLPYVMSIYLVSNYGFTIVLLFLLILIIGFVYEINTNALKINKHNKPNTDSLIYKL

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Chondrus crispus
Length
121 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.141 kDa
Sequence
MKLIFTEYSAILIFFAISSLLSSVIFLLSYFLIPQKPDQEKVSAYECGFNPFDDARATFDIRFYLVAILFLIFDLEISFLFPWSLVLGEISIIGFWSMIVFLVILTIGFIYEWYKGALEWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Paramecium tetraurelia
Length
120 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.449 kDa
Sequence
MGSMTLLFFVEHVFIFCMIFWLLTWVAEYFFKSKNNKQKHQFYECGIRALSELNIQINLNFSIVCVFLILYDVEFIFMYPFFFNFFLVNAGAFLVFFVFLFFVFYSLVYDSVQNSLALQL

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Cyanidium caldarium
Length
120 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.218 kDa
Sequence
MKFYFVEYFILFTYIIISFILACIISLLSYLLTTKKEDPEKTSAYECGFNPFDDTRTTFDVKFYLVAILFFNFCLEISFLFPWSIVLGNISYFGFVAIILFLFILTIGFIYEWKKGALNW

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Arabidopsis thaliana
Length
119 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.935 kDa
Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Raphanus sativus
Length
119 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.935 kDa
Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Brassica napus
Length
119 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.935 kDa
Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Acanthamoeba castellanii
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.228 kDa
Sequence
MTLEYIYIFIFFWGAFFISCLLIFLSYFLVYQESDIEKNSAYECGFQPFEDTRSKFNVRYYLIAILFMIFDLEIMYLFPWSISISTGSFFGVWAIFLFLIILTVGFIYEWQKGALEWD

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Allium cepa
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.791 kDa
Sequence
MSEFSPIFIYLVMSLLVSLILLGLPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Helianthus annuus
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.725 kDa
Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Zea mays
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.711 kDa
Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILFIGSLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Marchantia polymorpha
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.688 kDa
Sequence
MEFAPIFVYLVISLLLSLILIGVSFLFASSSSLAYPEKLSAYECGFDPFDDARSRFDIRFYLVSILFIIFDLEVTFLFPWAVSLNKIGLFGFWSMMVFLFILTIGFVYEWKKGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Metridium senile
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.517 kDa
Sequence
MYTEFYGILVLLIFSVVLSAIISGASYILGDKQPDREKVSAYECGFDPFGTPGRPFSIRFFLIGILFLIFDLEISFLFPWCVVCNQVFPFGYWTMIVFLAVLTLGLVYEWLKGGLEWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Solanum tuberosum
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.204 kDa
Sequence
MSEFAPICIYLVISPLVSLIPLGLPFLFSSNSSTYPEKSSAYECGLDPSGDARSRVDIRFYLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Triticum aestivum
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.725 kDa
Sequence
MLEFAPICIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Panax ginseng
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.268 kDa
Sequence
MSEFAPICIYLVISLLVSLIPLGVPFPFASNSSTYPDKLSAYECGFDPSGDARSRFDIRFYLVSILFIIPDPEVTFSFPWAVPPNKIDPFGSWSMMAFLLILTIGSLYEWKRGASDRE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Oenothera berteroana
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.755 kDa
Sequence
MLEFAPICISLVISLLLSLILLVVPFLFSSNSSTYPEKLSAYECGFDPFGDARSRFDIRFYLVSILFIIFDLEVTFFFPWAVSFNKIDLFGFWSMMAFLLILTIGFLYEWKRGALDWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Fasciola hepatica
Length
118 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.032 kDa
Sequence
MLFFAVLGLLFFLIFFLVLVFHAFLWNLDLGIFSGERSWVSSFECGFLSQRVTENYFSYTYFILLVFFVVFDLEVSLLLNMPLQGVLYKNFFSYLFFLVLLGIGFLVEVRRGYVRWAY

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Albinaria caerulea
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.546 kDa
Sequence
MILYVLPTSLSLCLLLMIIYLLTANLFKFASYELKTPFECGFDPLSNMRSPMTTRFFILTVLFLIFDVEVVLLFPVLSMVSFMTSPLIIMSIILFMMVLLIGLLYEMYYGVLDWVLN

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Anopheles quadrimaculatus
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.607 kDa
Sequence
MLMLSIMATIIFIITIVVMMLATLLSKKTLLDREKCSPFECGFDPMNSSRLPFALRFFLIAIIFLIFDVEIALLLPMVMIIKTSNLMNWTMTSFFFIFILLIGLYHEWNQGALEWNN

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Apis mellifera ligustica
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
14.036 kDa
Sequence
MKFIFMYFIFIILISSILLLLNKFISIYKKKDYEKSSPFECGFNPITKANLPFSLPFFLMTMMFLIFDVEIILFLPIIFYLKSSSTMISYLMISIFLILLITTLILEWMNNYLNWLF

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Heterololigo bleekeri
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.535 kDa
Sequence
MVTILIYLLILLIINVVLLLLGLIINKRSYSDREKNSPFECGFDPSIHTRAPFSMRFFLLAVIFLIFDVEIILLLPLTSNILNSNTHWPLTSSMIFLTILLIGLFHEWNQGSLDWMK

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Lumbricus terrestris
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
12.982 kDa
Sequence
MILTALSSAIALLVPIIILGAAWVLASRSTEDREKSSPFECGFDPKSTARIPFSTRFFLLAIIFIVFDIEIVLLMPLPTILHTSDVFTTVTTSVLFLMILLIGLIHEWKEGSLDWSS

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Sarcophyton glaucum
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.465 kDa
Sequence
MEFKGILILLIISGTLSILILGASYILGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYMGLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWEN

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Tetraselmis subcordiformis
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.668 kDa
Sequence
MIEYLAVLIYFLFSLALASLIIFLSFIFAPQKPDPEKISAYECGFDPFDDARGKFDIRFYLVAILFIIFDLEVTFLFPWAVTLGKIGFFGFWTMMAFLIILTIGFIYEWKKGALEWE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Paracentrotus lividus
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.051 kDa
Sequence
MMTTTIFLFSITSAVAIIFALAAHILPTRNNDGEKNSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAASFLTHPTTLILISLAFMAILDAGLVFEWINPPLEWAE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Branchiostoma floridae
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.268 kDa
Sequence
MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Branchiostoma lanceolatum
Length
117 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.268 kDa
Sequence
MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Pisaster ochraceus
Length
116 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.088 kDa
Sequence
MYNIIIIVLSILAVTAALVFAAHFLPSRKLDLENGSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPFPQALFIFNSSHVLYIATLFLAILLIGLIFEWTQGGLDWAE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Strongylocentrotus purpuratus
Length
116 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
12.734 kDa
Sequence
MTTIIFLFSITIAVAVVLGLAAHALPNRTSDSEKSSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAASLITPPSTLIPISMVFMVILTLGLVFEWINGGLEWAE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Patiria pectinifera
Length
116 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.34 kDa
Sequence
MIYTNNIFNFLTLFVSILIFLITTLITFAAHFLPSRNTDSEKSSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPLPFSVFFHPIHTPLILTVGLIFEWVQGGLDWAE

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Mytilus edulis
Length
116 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.101 kDa
Sequence
MVMGLSVVFVCIVCCLFTGLFMMLSEKRGLDREKCSPYECGFEPIGSARSPFSIRFFLVAVLFVVFDVEVVLLMPFAYMFFYGKSVLGILSSSGFLLILFVGLYHEYREGSLEWVG

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Locusta migratoria
Length
115 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.202 kDa
Sequence
MMMLMTSITISFLLPMIVMLLATTLSKKSINDREKSSPFECGFDPKLNMPFSIQFFLIAVIFLIFDVEIALILPIVIIMKTSNIMVWTLSTMLFIIILLVGLYYEWNQGALKWAN

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Allomyces macrogynus
Length
114 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
12.715 kDa
Sequence
MTYLVYIVFTIVLTVGLILVSYLLSQAQPDSEKVSAYECGFSPLGDARQKFDVSFYLIAILFIIFDLEVVFILPFASVIHNVSLLGGWITIIFLVILTIGFIYEFVSGAITDSF

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Rhipicephalus sanguineus
Length
114 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.431 kDa
Sequence
MIFYLHITIFLVVCLLMMLFFSLGFQGKKAKEKNSPFECGFDPFSLSRVPFSLKFFFVGIVFLIFDVEIVVILPFPLVMMTKNLMFVFSFTFINFLIVLGLLYEFKYSMLDRLK

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Artemia franciscana
Length
111 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
12.99 kDa
Sequence
MILIWLSIFMLVFIMLTLGMFVNKKVSLDREKSSPFECGFDPLNSSRTPFSIRFFVITLIFLIFDVEIYLLLPMVYLNMSSPTTYLIIFFTFILVAGVFYEWSEGALSWIK

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Ascaris suum
Length
111 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
13.102 kDa
Sequence
MLVLVMVVLFTLVLLFVFYIGNFVLSCKDFYKNKISSFECGFVSIGKIQNSFSIHFFIMMLMFVIFDLEVVMFLGILVSDLNSLISFFMLLMFIFGGFYMEWWYGKLVWLI

Gene
ND3
Protein
NADH-ubiquinone oxidoreductase chain 3
Organism
Artemia salina
Length
70 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 3 family.
Mass
8.443 kDa
Fragment
multiple
Sequence
FYYINPREFVNKKVCLDREKSSPFECGFDPLEFLSYPLFIRFFVITLIFLIFDVEIYLLLPMVYLNMSSP