About Products Protein Database Contact

Protein expression services for ND3 | NADH-ubiquinone oxidoreductase chain 3

Description
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Family
Belongs to the complex I subunit 3 family.
Species
Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)
Length
128 amino acids
Sequence
MFTIYTYLAPIVAMVLVVLNYLISNNNSYIEKDGPFECGFTSYQQTRSAFSVAFILVAILFLPFDLEMSSILPYVVSAYSNGTYGLSILVIFLLSLVIAFVYEINLGALNLERRYTPIVKPLMNKLYL
Mass
14.5 kDa
Simulated SDS-PAGE
Western blot of ND3 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make ND3 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here