Lypd8

Ly6/PLAUR domain-containing protein 8

255 amino acids

Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.

Belongs to the CNF-like-inhibitor family.

27.524 kDa

MRGVFIAGVIAAFAITVVDSLNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF

LYPD8

Ly6/PLAUR domain-containing protein 8

237 amino acids

Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.

Belongs to the CNF-like-inhibitor family.

25.265 kDa

MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETPVRLYQNMFCSAENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVSSNAECPACYESNGTSCHGKPWKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQFLSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLLALASLLLRGLLP

LYPD8

Ly6/PLAUR domain-containing protein 8

230 amino acids

Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.

Belongs to the CNF-like-inhibitor family.

24.724 kDa

MKSFLFAGIVVVLTVAAVDTLRCIQCNSLKDSCVAKNATECPSNATTSCTSFSTNFYHGEHPTWYEDHACSEENCSNTTVESFTVSVSENETFHFESQCCLGEPCNQTSNTTASPHQVGSGNMECPACYGNNETSCNETRKCYGERCVSIIAEFTNETKTLVLKGCSNVSISTCESLGAGNQTFRGVTFRKFECGDNFSTTTPLATTDTGSQASFTPLALASILLLSLLL