About Services Proteins Contact

LYPD8

Gene
Lypd8
Protein
Ly6/PLAUR domain-containing protein 8
Organism
Mus musculus
Length
255 amino acids
Function
Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.
Similarity
Belongs to the CNF-like-inhibitor family.
Mass
27.524 kDa
Sequence
MRGVFIAGVIAAFAITVVDSLNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF

Gene
LYPD8
Protein
Ly6/PLAUR domain-containing protein 8
Organism
Homo sapiens
Length
237 amino acids
Function
Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.
Similarity
Belongs to the CNF-like-inhibitor family.
Mass
25.265 kDa
Sequence
MKGILVAGITAVLVAAVESLSCVQCNSWEKSCVNSIASECPSHANTSCISSSASSSLETPVRLYQNMFCSAENCSEETHITAFTVHVSAEEHFHFVSQCCQGKECSNTSDALDPPLKNVSSNAECPACYESNGTSCHGKPWKCYEEEQCVFLVAELKNDIESKSLVLKGCSNVSNATCQFLSGENKTLGGVIFRKFECANVNSLTPTSAPTTSHNVGSKASLYLLALASLLLRGLLP

Gene
LYPD8
Protein
Ly6/PLAUR domain-containing protein 8
Organism
Bos taurus
Length
230 amino acids
Function
Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.
Similarity
Belongs to the CNF-like-inhibitor family.
Mass
24.724 kDa
Sequence
MKSFLFAGIVVVLTVAAVDTLRCIQCNSLKDSCVAKNATECPSNATTSCTSFSTNFYHGEHPTWYEDHACSEENCSNTTVESFTVSVSENETFHFESQCCLGEPCNQTSNTTASPHQVGSGNMECPACYGNNETSCNETRKCYGERCVSIIAEFTNETKTLVLKGCSNVSISTCESLGAGNQTFRGVTFRKFECGDNFSTTTPLATTDTGSQASFTPLALASILLLSLLL