Description
Secreted protein specifically required to prevent invasion of Gram-negative bacteria in the inner mucus layer of the colon epithelium, a portion of the large intestine which is free of commensal microbiota. Prevents invasion of flagellated microbiota by binding to the flagellum of bacteria, such as P.mirabilis, thereby inhibiting bacterial motility in the intestinal lumen. Segregation of intestinal bacteria and epithelial cells in the colon is required to preserve intestinal homeostasis.
Family
Belongs to the CNF-like-inhibitor family.
Sequence
MRGVFIAGVIAAFAITVVDSLNCTQCYTYNSTCDGQATECNEQSFSCVESSINSTLGGFLHVYQNKFCSASNCTENSTEVAFTVHLFDDQRYHFASQCCQGESCNATHSESGTQNVTDMQCMSCYGHNKTLCEEKPQKCYEGEQCVFIIAEMVNGSGRVELKGCSDISNSTCQFLSPGNTTVGEFVFKSVECTQPTEYTNSTTTIPPITNTSLTSVTRPGIKTSPASVTPQASMGTKASFTSSIFGSLLLLKLLF
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service