About Services Plasmids Contact

Atu2573

Gene
Atu2573
Protein
Amino acid--[acyl-carrier-protein] ligase
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
327 amino acids
Function
Catalyzes the ATP-dependent activation of L-alanine, and to a lesser extent of L-glycine and L-serine, and their transfer to the phosphopantetheine prosthetic group covalently attached to the vicinal carrier protein Atu2571 of yet unknown function. May participate in nonribosomal peptide synthesis or related processes. L-proline and L-glutamate are very poor substrates whereas D-amino acids are not substrates for ATP-dependent activation. Does not display tRNA aminoacylation activity.
Similarity
Belongs to the class-II aminoacyl-tRNA synthetase family. Amino acid--[acyl-carrier-protein] ligase subfamily.
Mass
36.344 kDa
Sequence
MTVFSAIPPISCWFTGRTPASWDKTMDMQTSFLDRLFEEGLLIETGVDGLYGRSGQFEDVIAAFERLIDRTGGADGAEAIRFPPGINRAYFEKSGYMKSFPQLAGTVHSFCGCELDHVSLLKSMDEGGDWTKDQKATDIVLTPAACYPLYPTIAKRGALPAGGGLYDIQSYCFRHEPSKDPARQQLFRMREYVCMGTESDVTEFRQTWMDRGVEMMKAVGLDVTIDIANDPFFGRAGKMLANNQRDQNLKFELLIPVTSATNPTACMSFNYHQDAFGQKWGLNLENGDVAHTACVGFGLERIALALFAHHGLDVKKWPAKVVETLWG